KEGG   Schistosoma mansoni: Smp_179560Help
Entry
Smp_179560        CDS       T01095                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase-related
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
smm  Schistosoma mansoni
Pathway
smm00010  Glycolysis / Gluconeogenesis
smm00562  Inositol phosphate metabolism
smm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_179560
   00562 Inositol phosphate metabolism
    Smp_179560
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Smp_179560
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Smp_179560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 CLTH
Motif
Other DBs
NCBI-GeneID: 8344923
NCBI-ProteinID: XP_018647410
GeneDB: Smp_179560
UniProt: G4M1S9
Position
Unknown
AA seq 510 aa AA seqDB search
MGALFSAFCAIATFLLFIFNYEPETFFSGLSSKTAYRFCGLKSYEDKVSVQFKRCTLVHV
NVLLRHGTRAPDSKSIKSFTDLHERLKESYNSGSPIPYKLLTHPIPFKNAAVKELLPRGF
QEHDGLGRRFFNLMRQYFDFTIENVNFYSSSIDRCIASGRAFYNGFINGPTIKPIWNRTL
YCGNDEIPNSCILNDELSEINNDHYKKNITINNYLLRFFADCKNYIEKIENNKSAIQEYY
KFFKSNYIMNSYENFIKRFTLKRENYKLDDLKTIFLACAYEVAAMDDYDDLSPWCSLLTP
YDYPVWEYLADLKHYWRKSYGYELNYEQSCPLLGEIIQQIYNVAINFQKHNYSQNNPTLH
RGSFWFGHAETILPIVAALGIFNNSVGHSTLHKLTADNFDERLKMIYDTDVPSPTMFRTS
YIAPFAGNVAFLLYYCPDLEDSDNDLDKFRIKVLINEKTIAWPLSSSIQPPTLDHPGETN
ASLTTILQYFNGCMPNNYDNNKVCSLHKTL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggggctctgttttcagccttctgtgcaattgctacttttttactttttattttcaac
tatgaaccagaaacgtttttttcgggcttgtcatcaaaaacagcgtatcgcttttgtggt
ttgaaatcatatgaagataaagtgtctgttcagtttaaaagatgcaccttggtgcatgtt
aatgtattactcagacatggaactagagcaccagattccaaatccattaaatcttttaca
gatttacatgagcgtcttaaagaaagttataacagtggatcaccaattccttacaaactt
ttaacacatccaataccttttaaaaatgctgctgtaaaagaacttttacctagaggattt
caagaacatgatggtttaggcagacgtttttttaatctcatgcgacagtatttcgatttt
acaattgaaaatgttaatttctactcgagttctattgatcgttgtattgcaagcgggcga
gcattttataacggttttatcaatggaccaactataaaacctatatggaatcgtacacta
tattgtggtaatgatgaaataccaaatagttgtatacttaatgatgaattatcagaaatc
aataatgatcattacaagaagaatataacaattaataattatttattaagattttttgct
gattgtaaaaattatattgaaaaaattgaaaataataaatcagctatacaagaatattat
aaattttttaaatcaaattatattatgaattcttatgaaaattttattaaaagatttacg
ttaaaacgtgaaaattataaattggatgatttgaaaacaatatttttggcttgtgcgtat
gaagttgctgcaatggatgattatgacgatctatcaccttggtgcagtctcttaacaccc
tatgattatccagtatgggagtatttagcagatttaaagcattattggcgtaaatcgtat
ggttatgaattgaattatgaacaatcatgtcctttactcggtgaaataatacaacaaatt
tataatgtagctataaattttcagaaacacaactatagtcaaaataacccaacattacat
cgtggaagtttttggtttgggcatgcagaaactattctacctatagtcgctgctttaggt
atattcaataactcggttggtcattcaactttacacaagttaacagcagacaactttgat
gaaagattaaaaatgatctatgatacagatgttccatcgcctacaatgtttcgtactagt
tatatagcaccatttgctggcaatgtggcttttctattgtattactgtcccgatttagaa
gattctgataatgatctggataaatttcgtatcaaagtattaatcaatgagaaaacaatc
gcttggccactatctagttcaatacaaccgcctacattagatcatccaggtgaaacaaat
gcttctctaacaactatactacaatatttcaatggttgtatgcctaataattatgacaat
aataaagtttgttcacttcataagacattgtag

DBGET integrated database retrieval system