KEGG   Streptococcus macedonicus: SMA_0798Help
Entry
SMA_0798          CDS       T01674                                 

Gene name
acoC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smn  Streptococcus macedonicus
Pathway
smn00010  Glycolysis / Gluconeogenesis
smn00020  Citrate cycle (TCA cycle)
smn00620  Pyruvate metabolism
smn01100  Metabolic pathways
smn01110  Biosynthesis of secondary metabolites
smn01120  Microbial metabolism in diverse environments
smn01130  Biosynthesis of antibiotics
smn01200  Carbon metabolism
Module
smn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMA_0798 (acoC)
   00020 Citrate cycle (TCA cycle)
    SMA_0798 (acoC)
   00620 Pyruvate metabolism
    SMA_0798 (acoC)
Enzymes [BR:smn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMA_0798 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CCF02089
UniProt: H2A5U7
Position
797213..798607
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEVIGYIGAEGETLVDSVGEKHVEPLASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDRGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTAQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPIVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggagaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccagcaggtgatgtcgtagctgttaccgaagttatcggctatatcggagcagaaggt
gaaactcttgttgattctgtgggtgagaaacatgttgaaccgttagcatcggctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagctagcacgtgagcgaggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacagaggtgttgac
cttgagacactggtaggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacagcgcaagcg
ggagctttggctgatgttacggctgcaagtgacggagttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaaggggatgagccattcttactttacggcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccctgcgtaagcaacttattgagcca
attatggcaaagacgggttataaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacatcgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcagctgaaatgtctggctca
acattcaccataacgaaccttggaatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaatccttgggatttcagcaactattgaaacacccatcgttcatgac
ggtgaagtggttattcgcccaattatgggaatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttctcgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system