KEGG   Streptococcus macedonicus: SMA_1241Help
Entry
SMA_1241          CDS       T01674                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase/Homolog of homocysteine-binding domain
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
smn  Streptococcus macedonicus
Pathway
smn00270  Cysteine and methionine metabolism
smn00670  One carbon pool by folate
smn01100  Metabolic pathways
smn01110  Biosynthesis of secondary metabolites
smn01120  Microbial metabolism in diverse environments
smn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SMA_1241
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SMA_1241
Enzymes [BR:smn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SMA_1241
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     SMA_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: CCF02532
UniProt: H2A703
Position
complement(1207130..1208986)
Genome map
AA seq 618 aa AA seqDB search
MSRLLERLKTDILVADGAMGTLLYANGLDNCYEAYNLTHPDKISAIHHAYLEAGADIIQT
NTYAAKRHRLKGYAYDDQVKEINQAGVKIAREATGDDAFVLGTVGALRGLKQCDLTLDEI
IEETLEQVGYLIETNQIDGLLFETYYDEEEIIEVLKAVRPITDLPIITNIALHEAGITEN
GRPLVEILGKLVMLGADVVGLNCHLGPYHMIKSLKQVPLFAQSYLSVYPNASLLSFVDDN
GSGQYGFSQNADYFGKSAELLVAEGARLIGGCCGTTPDHIRAVKRAVKGLKPVERKFVTP
MVEEAELIKAAKQSETLVDRVKREVTIIAELDPPKTLDIAKFTEGVKALDKAGISAITLA
DNSLAKTRICNVSIAALLKNEISTPFLLHLSCRDHNMIGLQSRLLGMDVLGFNHVLAITG
DPSKIGDFPGATSVYDATSFKLLALIKQLNKGQGYSGASIKKETNFTAAAAFNPNVKNLS
RCGRLIERKVAAGADYFITQPVFNTEIIDELANLTRDYEAPFFVGIMPITSYNNAIFLHN
EVPGIQLSDEFLAKLEAVKDDKETCQKLALEESKQLIDRALKHFKGIYLITPFMRYDLTV
ELIDYIHQKVELKNQRIS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgattattagaacgtttaaaaacagatattctggtagccgacggtgctatggga
actcttctttacgccaatggtcttgacaattgctacgaagcttataatcttacacatcca
gataaaatttcagccattcatcatgcttatcttgaggcaggggcagacattatccaaacc
aatacctatgctgctaaacgccatcgtctgaaaggctatgcttatgatgaccaagttaag
gaaatcaatcaggctggtgttaaaattgctagagaagctacaggtgatgatgcttttgtt
cttggaactgttggggctcttcgtgggcttaaacaatgtgatttaacccttgatgaaatt
attgaggagactttggaacaagtcgggtatttgattgaaacgaatcaaattgatggtttg
ctttttgaaacttattatgatgaagaagaaattatcgaagttttaaaagctgttagaccg
ataactgatttgccaattataactaatattgctctccatgaagctggaattacggaaaat
ggtcgtcctttagttgaaattctagggaaattagtcatgttaggtgctgatgtggttggc
ttgaattgccacctcggcccctatcacatgattaagtcactgaaacaagttccgcttttt
gctcagtcttatttgtctgtttatccaaatgctagtttgttgtcttttgttgatgataat
ggcagcggtcagtatggctttagtcaaaatgctgattatttcggaaaaagtgcagaactt
cttgtggcagaaggtgcgcgtttgataggtggttgttgtggaacaacgcctgatcatatc
agagcggtaaaacgtgctgttaaaggattaaaacctgttgaacgaaaatttgtgacacca
atggttgaagaagcagagcttatcaaagcggctaaacaatcagagacattggttgatagg
gtcaaaagagaagttacgattattgcggagttagacccaccaaagacgcttgacattgcg
aaatttacggaaggggtaaaagccttagacaaagcaggaatttcagccattaccttagca
gataattcgctagctaagacgcgaatttgtaatgttagtatcgcggctctattgaaaaat
gaaatttcaacaccgtttcttttgcatttatcctgccgtgaccataatatgattggtttg
caatcgcgacttttgggaatggacgttttaggatttaatcatgtccttgccattacggga
gacccgtcaaaaatcggtgattttcctggtgccacaagtgtttatgatgccacaagcttt
aaattgttagcactcataaaacagctcaataaaggtcaaggatacagtggagctagtatc
aagaaagagaccaattttacagcagctgcggcttttaacccaaacgtcaaaaatctatca
cgctgtggtcgtttaatcgaaagaaaggtagcggcaggagcagattatttcatcacacaa
cctgtttttaacacagagattattgatgaattagccaatttaacacgagattatgaagcg
ccattttttgtaggtatcatgccgattacaagctataataatgctattttccttcataat
gaagttcctggtatccaactatcagatgaatttttagcaaaattagaagctgttaaagat
gataaagaaacctgccaaaaattggctttggaagaaagtaaacaattaattgaccgtgct
ttgaagcattttaaggggatttatctcatcacaccatttatgcgctatgacttgacagtt
gagttgattgattacattcaccaaaaagttgagttaaaaaatcaaagaatatcttaa

DBGET integrated database retrieval system