KEGG   Selaginella moellendorffii: SELMODRAFT_104343Help
Entry
SELMODRAFT_104343 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
smo  Selaginella moellendorffii
Pathway
smo03040  Spliceosome
smo04141  Protein processing in endoplasmic reticulum
smo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:smo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SELMODRAFT_104343
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SELMODRAFT_104343
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SELMODRAFT_104343
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:smo01009]
    SELMODRAFT_104343
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:smo03041]
    SELMODRAFT_104343
   03009 Ribosome biogenesis [BR:smo03009]
    SELMODRAFT_104343
   03110 Chaperones and folding catalysts [BR:smo03110]
    SELMODRAFT_104343
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_104343
   03051 Proteasome [BR:smo03051]
    SELMODRAFT_104343
   03029 Mitochondrial biogenesis [BR:smo03029]
    SELMODRAFT_104343
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smo04147]
    SELMODRAFT_104343
Protein phosphatases and associated proteins [BR:smo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SELMODRAFT_104343
Spliceosome [BR:smo03041]
 Complex B
  Other components
   Prp19 complex
    SELMODRAFT_104343
 Complex C
   Prp19-CDC5 complex
    SELMODRAFT_104343
Ribosome biogenesis [BR:smo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    SELMODRAFT_104343
Chaperones and folding catalysts [BR:smo03110]
 Heat shock proteins
  HSP70 / DNAK
   SELMODRAFT_104343
Membrane trafficking [BR:smo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SELMODRAFT_104343
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SELMODRAFT_104343
Proteasome [BR:smo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SELMODRAFT_104343
Mitochondrial biogenesis [BR:smo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    SELMODRAFT_104343
Exosome [BR:smo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SELMODRAFT_104343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 9645846
NCBI-ProteinID: XP_002975959
JGI: 104343
UniProt: D8RY91
Position
Unknown
AA seq 107 aa AA seqDB search
MAKEGPAVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVTAGAAEKPMITV
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaggtcccgctgtggggattgatctgggcacgacgtattcttgcgtcggt
gtgtggcagcacgatcgggtggagatcatcgccaatgatcaaggaaacaggacgacgcca
tcgtatgtggccttcaccgacacggagcggctgattggcgatgccgccaagaaccaggtc
gcgatgaatcccgtcaacactgtcttcgatgcgaagcgtttgatcggcaggcgattctcg
gactcttcggtccaaagcgacatgaagttgtggccattcaaggtcactgctggtgccgcc
gagaagccgatgatcacggtc

DBGET integrated database retrieval system