KEGG   Selaginella moellendorffii: SELMODRAFT_105711Help
Entry
SELMODRAFT_105711 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00020  Citrate cycle (TCA cycle)
smo00620  Pyruvate metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Module
smo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_105711
   00020 Citrate cycle (TCA cycle)
    SELMODRAFT_105711
   00620 Pyruvate metabolism
    SELMODRAFT_105711
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SELMODRAFT_105711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N DUF515 ACAS_N
Motif
Other DBs
NCBI-GeneID: 9649169
NCBI-ProteinID: XP_002976701
JGI: 105711
UniProt: D8RZW8
Position
Unknown
AA seq 605 aa AA seqDB search
VLGMPALSPTMTQGNVIQWKKKEGDKVSPGDVLCVIETDKATVDFESVEEGFLAKILVPG
GTNNVSVGQTIGVMVEDSSDIGKVSSSDFAAPPAAKKEAQPSSKPSSTAQQANVKPPPAS
NLPPHIVLGMPALSPTMTQGNIVEWKKKERDKVSAGDVLCTIETDKATVDFESVEEGYLA
KIASPSGSKNVPIGQTIGVMVRDSTPCSGQPPATKTEGKPQADASSKVSVMSKPPAAAGS
KALSRVGPSVRRLLAESGLDASSINGTGPRGVVLKGDVLAAIKGGTKPGKPPKDAKSRPS
PPTSLDFEDIPTSQIRRIIAKRLIESKFGIPHFYISADAILDSTLLLRKEMKEKHGAAVS
VNDFVIRATALALRSVPEANAFWDEKAEEIVFHKTIDISIAVATDKGLITPIVKNADLKT
LSAISTEVKALAERARTGKLKPEEFQGGTFSISNLGMFPVDRFCAIINPPQACILAVGKG
EKVVVWEDCSESGGRPRTVTKMGMTLSADNRVFDTTIAGKSTPFFLPSRHKLLFPSFRSA
ARGSLSQFAGPGEDAAVKILVRKFLFLDHDGGDGVNSIRNVVAGLPWTIETRNKRRPPRC
VPRIL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gttctcggaatgcccgcgctttctcccactatgacacagggaaacgttatacagtggaaa
aagaaagagggtgacaaggtgtccccgggagatgttctgtgcgtgatagaaactgacaag
gctactgtcgatttcgagtctgtggaggaaggatttctagcaaagatcctggttccgggg
ggcacaaacaacgtttcagttggtcagacaatcggagttatggtagaggactcgtctgat
atcggtaaagtatcgagcagtgattttgctgctcccccggcagccaaaaaggaagcacag
ccctcatcgaagccatcgtccacagcacagcaagccaacgtcaagcctcccccagcatcg
aacttgccgccgcacattgttcttgggatgccagcattgtctccaactatgacgcaagga
aacattgtggaatggaaaaaaaaggaaagagacaaggtctccgcgggggatgttctctgt
acaatagaaacggataaagcaacagtggattttgagtcggtggaagaaggatatttggct
aagatagcatctccttcaggatcgaagaatgtgccgattggtcaaactatcggagtcatg
gtacgtgattccactccttgtagtggtcagccccctgccacaaagaccgagggaaaacca
caggcagatgcttctagcaaggtttccgtgatgtccaaacctccagcagctgctggctct
aaggctttgtcaagagtaggcccatcagtaagaaggttacttgctgaaagcgggttggat
gcttcatccataaatggtacaggtcctcggggggtggttttgaaaggtgatgttttggct
gccattaaaggtggcacgaaacctgggaaacctccaaaggatgctaagtctcgcccgtca
cctcccacgtctctggattttgaagatatacccactagtcagatcagaagaatcattgcg
aagaggctgatcgagtccaagtttggtattcctcacttctacatatctgctgacgcgatt
cttgattcgacattgttgttaagaaaggagatgaaagagaaacatggtgctgctgtttcg
gttaatgatttcgtgatacgagcgacggctcttgcgttaagatccgtgcccgaagcaaat
gctttttgggatgagaaggctgaagagattgttttccacaaaacaatagatatctccata
gcagttgctactgataagggcttgattactccaattgtaaagaatgcggatttgaagact
ttgtctgcaatctcgacggaggtgaaagctcttgccgaaagagcaagaactgggaagctg
aaacctgaggaattccaaggaggcacgttcagtatctcgaatcttggaatgttccccgtg
gacagattctgtgctattatcaatccaccccaggcttgcattcttgctgttggcaaaggc
gagaaagtcgttgtctgggaagactgttcggaaagcggaggaaggccacgtaccgtgacc
aagatgggcatgactttatcggcagacaacagagtttttgacaccacaatcgctggtaag
agcactccgttctttcttccttcacgtcataaattactcttcccttcattcaggtcggct
gctagaggctctctcagccaatttgcaggacccggagaggatgctgctgtaaaaatcctc
gtcaggaaatttttgtttttggatcacgacgggggtgatggtgtaaattcaataaggaac
gtggtggccgggctgccgtggacaattgagacacgcaataaacggcggccaccgcgatgc
gttccacgtattctttga

DBGET integrated database retrieval system