KEGG   Selaginella moellendorffii: SELMODRAFT_11293Help
Entry
SELMODRAFT_11293  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
smo  Selaginella moellendorffii
Pathway
smo00906  Carotenoid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    SELMODRAFT_11293
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     SELMODRAFT_11293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 9633178
NCBI-ProteinID: XP_002970754
JGI: 11293
UniProt: D8RIE6
Position
Unknown
AA seq 506 aa AA seqDB search
AVALCDTVENFISTYIDLREFPPSQDPQIQLADNFAPVAEFPPTPCRRVTGEIPRCLRGG
AYIRNGSNPLHPPPAGYNYFDGHGMLHSVKFGDEEEQAPIYCARFTQNNRFVQEQAAGKP
LFPYTLGTMSSYAGLARFGLFVMRTALGLINILGGMGTSNAGMAYFDRRILAMSEDDMPY
AVSITPAGDLITMGRYSFNNRLFLPMCAHPKIDPISGELFAVSFNPVINPHLRYFWASPD
GRKSPDFDVWLPDPCLFHDFAITENYAILPENQLVMKFQDVVLKNKLVIDGDTAKVPRFG
VIPRIPTVGYSGVRWIDVPDWTSFHYINAWEEGTDKIVVLSSSITPVEHFFDDFAGLSNR
LHEIHLDLRSGRSWKQHVCSAGLDFGQINQKFLGRKNRYVYMCYYGPWPKISGLAKVDLD
APRLPRVVIDGTSQFCGEPFFVANGKEEDDGYVLSYIHDEESGVSELLVMDAKSPTLETM
ASIELPARVPYGFHGIFINSDQIANQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gcggtagccctgtgcgacacggtggagaatttcatctccacgtacattgatcttcgcgag
tttcctccctcgcaagacccccagatccagctcgcggataatttcgcgcctgttgcagag
ttcccgccaacgccgtgccgccgagtcactggcgagatccctcgctgcctccgcggcggt
gcttacatccgcaatggctccaatccactccatccccctcccgccggctacaactacttc
gacggccacgggatgctccactctgtcaagttcggcgatgaagaagagcaagctccaatc
tactgcgcgcgattcacccagaacaatcgattcgtccaggagcaagcagcgggcaagcct
ctcttcccctacacactgggcaccatgagcagctatgccgggctcgcacgattcgggctg
ttcgtgatgcgcacggctctgggcctgatcaatatcttgggcgggatgggaacctccaac
gctgggatggcctacttcgatcgccgaatcctggccatgtccgaggatgatatgccatat
gccgtgagtatcacaccagcaggggatttgatcaccatgggccgctacagcttcaacaac
cgattgttcttgccgatgtgcgctcatccaaagatcgatccaatctctggcgagctcttc
gcggttagcttcaatccggtgatcaatccccacctccgctacttctgggcgagcccggac
gggaggaagagccccgatttcgacgtgtggctgccggacccgtgcttgtttcacgacttc
gcgataacagagaactacgcaatccttccagagaatcagctcgtgatgaagttccaggat
gtagtgctcaagaacaaacttgtcattgatggagataccgccaaggttcccagattcggg
gtgatccctcgcatcccgaccgtgggatattccggcgttcgctggatcgacgtcccggat
tggacgtcattccactacattaacgcctgggaggaagggacggacaagatcgtcgtgctc
agctcgtccattacgccggtagaacatttctttgacgatttcgccggattgtccaacaga
ttgcacgagatccacctcgaccttcgatctggacggtcgtggaagcaacacgtgtgctcg
gccggactggattttggacagatcaaccagaagttcctggggcggaagaatcggtacgtc
tacatgtgctactatgggccatggcccaaaatctcgggcctggccaaggtcgatctggac
gctccacggctgcccagggtggtcatcgacggaacgagtcagttttgtggggagcctttc
tttgtggcgaatggcaaggaggaagacgatggatacgtcttaagctacatccatgatgag
gaaagtggtgtctcggagcttttggtcatggatgccaaatcgcccacgcttgagacaatg
gcttctatagagttgcctgctagagttccatatggattccatgggatctttataaattcc
gatcaaatagccaaccag

DBGET integrated database retrieval system