KEGG   Selaginella moellendorffii: SELMODRAFT_121738Help
Entry
SELMODRAFT_121738 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smo  Selaginella moellendorffii
Brite
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SELMODRAFT_121738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 PrmA Methyltransf_25 Methyltransf_11 Methyltransf_32 Ubie_methyltran MTS Methyltransf_23 CMAS Methyltransf_16 Methyltransf_3
Motif
Other DBs
NCBI-GeneID: 9649692
NCBI-ProteinID: XP_002985198
JGI: 121738
UniProt: D8SPM3
Position
Unknown
AA seq 220 aa AA seqDB search
KSLVKLLREEGAVKSDRVACVMEKLDRALFIAEGERNLAYMDCPMQIGFNATISAPHMHG
SCLELLNKHLQPGMHALDVGSGTGYLTAAFALLVGDQGRAVGVEHIPELVEQSIKNVKRS
PAASLLEPGVLSLHVGDGRLGWPEHAPYNAIHVGAAAPQVPQPLIDQLKPGGRMVIPVGE
GAQELVVIDKGPDGSLKQWTASSVRYVPLTSKDEQLRGGV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
aaatccctcgtcaagctcctccgggaggagggcgcggtgaaatccgacagggtcgcctgc
gtcatggagaagctggatcgcgccttgttcatcgccgagggcgagaggaatctggcgtac
atggactgtccaatgcagattggattcaatgccaccatctcggctccacacatgcatggc
tcgtgcctggagcttctcaacaagcatctccagccgggaatgcacgctctcgacgttggc
tccggaactggttacttgaccgctgctttcgctcttctggtgggcgatcaaggtcgcgct
gtaggagtggaacacattccggagctcgtcgagcagtcgatcaaaaacgttaagcgatcc
ccggcggcttcactgctggagcccggcgttctttctctgcacgttggagatggtcgactt
ggctggcccgaacacgcgccatacaacgccattcacgttggagccgcggctccgcaagtg
cctcagccactgatcgatcagctcaaaccaggcggccggatggtgataccggttggggag
ggagcgcaagagctggtggtgatcgacaaggggcccgatggatcgctcaagcagtggacc
gcgtcgagcgtgaggtatgttcctctaactagcaaggacgagcagctcaggggaggagta
tga

DBGET integrated database retrieval system