KEGG   Selaginella moellendorffii: SELMODRAFT_129301Help
Entry
SELMODRAFT_129301 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
smo  Selaginella moellendorffii
Pathway
smo00240  Pyrimidine metabolism
smo00250  Alanine, aspartate and glutamate metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SELMODRAFT_129301
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_129301
Enzymes [BR:smo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SELMODRAFT_129301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace DUF3848
Motif
Other DBs
NCBI-GeneID: 9629848
NCBI-ProteinID: XP_002989168
JGI: 129301
UniProt: D8T0T6
Position
Unknown
AA seq 316 aa AA seqDB search
MLGRKFEVEHVLEAQQFDRELLEGIFGVAKEMEAIVEGRSGGGSTMLKGYLMATLFYEPS
TRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAA
KQAAAVSSIPVINAGDGPGQHPTQALLDVYTIQRETGRLDGIKVGLVGDLANGRTVRSLA
YLLAKYDGVKFYFVSPDVVKMKDDIKEYLTSKNIEWEESKDLMEVASKCDVIYQTRIQRE
RFGDKIELYNQARGKYIVDRKVVDVLQSHAVVLHPLPRLDEITTEVDVDPRAAYFRQAKN
GLFIRMALLKLLLLGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctagggcggaagttcgaggtggagcacgtcctcgaggcgcagcaattcgaccgggag
ctgctggaggggatctttggcgtggccaaggagatggaggcgatcgtggaggggagatcc
ggcggcggctccacgatgctcaagggatatctcatggcgacgctgttttacgagccatcg
acgaggacgaggctgtcgtttgagtcggccatgaagcgcctgggtggagaagtgctcacc
acggagaatgctcgcgagttctcgtcggctgccaaaggggagacgctcgaagacacgatc
aggacggtggaaggctactcggatataatcgtgatgagacactttgagagtggagctgcc
aagcaagctgccgctgtgtcgagcatcccagtgatcaatgctggcgatggacctgggcag
catcccacgcaggcactgttagatgtttacacgattcagagagagaccgggcggctcgac
gggatcaaagtcgggctcgttggagaccttgccaacggaagaactgttcgatctctggcc
tacttgctcgccaagtacgatggtgtcaagttctacttcgtctctccagacgtggtgaag
atgaaggatgatatcaaagagtatcttacctccaagaacatagagtgggaagagtcgaag
gatctcatggaagtggcatccaaatgcgatgtcatttaccagacgcgcattcaacgcgag
agatttggcgacaagatcgagctctacaaccaggcccgtggaaaatacattgtggaccgc
aaagtagtggatgtgcttcaaagccatgccgttgttttgcatcctcttcccaggcttgac
gagattaccacagaagtagatgtcgatccaagagctgcgtattttagacaggccaaaaat
ggtcttttcattcgtatggctttgctgaagttgctattgcttgggtggtga

DBGET integrated database retrieval system