KEGG   Selaginella moellendorffii: SELMODRAFT_129658Help
Entry
SELMODRAFT_129658 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smo  Selaginella moellendorffii
Pathway
smo00480  Glutathione metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_129658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smo02000]
    SELMODRAFT_129658
Enzymes [BR:smo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SELMODRAFT_129658
Transporters [BR:smo02000]
 Other transporters
  Pores ion channels [TC:1]
   SELMODRAFT_129658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 9650490
NCBI-ProteinID: XP_002989304
JGI: 129658
UniProt: D8T154
Position
Unknown
AA seq 232 aa AA seqDB search
MGEEGLKLLSFWSSPYACRARLALDLKGLRYDLQEEDLFNAKSALLLESNPVHKKIPVLI
HNGKAICESMNIVEYVDEVWPDRGTGFLLPRDDAFARATARFWADFFLSLTAASFKAAIS
SGEEKERANDEMIQDMVALERFLESQGGVFFSGSNTSMGFVDIAASFLPWWIPTYTEIGR
LRVPGPDTCPLLHRWIAAVKDSPEAKPAFPDQQELLDFTKVRFEDVKKRFAQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggagggattgaagctcttgagcttttggtcgagcccctacgcgtgccgggcg
aggctggcgctcgatctcaagggcctgcgctacgatctccaggaggaggatctcttcaat
gccaagagcgcgctgctgctggaatccaatccggtgcacaagaaaatccccgtgctcatc
cacaatggcaaggcgatctgcgaatccatgaacatcgtcgagtatgtggacgaggtgtgg
ccggatcgcggcaccggattcctcctgccgcgcgatgacgcattcgcgcgggccactgct
cgcttctgggcggatttcttcctgagcttaacggcggcatcgttcaaggccgcgatctcg
agcggcgaggagaaggagcgcgcaaacgatgagatgatccaagacatggtagcgctggag
cgatttcttgagagccagggaggcgtgttcttcagtggaagcaacacgagcatgggcttc
gtggacatcgccgcctcctttcttccatggtggatcccgacgtacacggagatcggacgg
ctccgcgtgcccggccccgacacttgtcccctcctccaccgctggatcgccgcggttaaa
gactctccagaggccaagcccgcttttcccgaccagcaagaactgttggatttcaccaaa
gtccgcttcgaggacgtgaagaagagatttgcccagtaa

DBGET integrated database retrieval system