KEGG   Selaginella moellendorffii: SELMODRAFT_130267Help
Entry
SELMODRAFT_130267 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K21888  glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
smo  Selaginella moellendorffii
Pathway
smo00053  Ascorbate and aldarate metabolism
smo00480  Glutathione metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SELMODRAFT_130267
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_130267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smo02000]
    SELMODRAFT_130267
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     SELMODRAFT_130267
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SELMODRAFT_130267
Transporters [BR:smo02000]
 Other transporters
  Pores ion channels [TC:1]
   SELMODRAFT_130267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 9638110
NCBI-ProteinID: XP_002989736
JGI: 130267
UniProt: D8T274
Position
Unknown
AA seq 138 aa AA seqDB search
FMQHNPSGLMPVLRDGPDWIQDSDKIIVHVEKKFKEPSLKTPHEFKIGFSSVFPVFTNWL
KSKDRSAPAKTYQRAHSFRGVIEETLLCNVLLIYLVSQGPYIAGKTPTDSNFALAPKLRH
AGMALEHFMDFVFPSNLR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
tttatgcaacacaatccctctggcttgatgccggttctccgcgacggtcctgattggatt
caagattcggacaaaatcattgtgcatgtggagaagaagttcaaggagccgtctctgaaa
actccacacgaattcaaaattggattttccagcgtctttccagtgttcactaactggctc
aagtccaaggaccgaagcgctccagcaaagacatatcaacgagctcacagctttcgagga
gtaattgaagaaacacttctttgtaatgttcttctcatttatcttgtttctcagggccct
tacatcgctgggaaaactcccactgattccaactttgctctggctccaaagctccgtcat
gctggaatggctctcgagcacttcatggacttcgtcttccccagtaacctccggtaa

DBGET integrated database retrieval system