KEGG   Selaginella moellendorffii: SELMODRAFT_130742Help
Entry
SELMODRAFT_130742 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smo  Selaginella moellendorffii
Pathway
smo00480  Glutathione metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_130742
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smo02000]
    SELMODRAFT_130742
Enzymes [BR:smo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SELMODRAFT_130742
Transporters [BR:smo02000]
 Other transporters
  Pores ion channels [TC:1]
   SELMODRAFT_130742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_C GST_N GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 9629978
NCBI-ProteinID: XP_002989894
JGI: 130742
UniProt: D8T2U5
Position
Unknown
AA seq 409 aa AA seqDB search
MASTAEVSSWEELSEKVSRLPGYNAVAAAARLPNVQQRDFGDTSIAQVVFYRDNSSWCPY
CQRVWLQLEEKRIPYKVEKINMNCYGPKPAWYLEKVPSGLLPALELKGQLLTESLDIMLI
LEEAFPERHPLLPPKGSPKANAVDGLLRLERLLAGAWLSRLRSFWTKPGQFEGAMDDVDG
ALAKFGGPFFLGDTFSLVDAVYAPFLERIAASMPYWQGVMIRGETRWPHLQAWFDAMDAK
PSYQAVKSDDYTITHTLEPQIGACRALPAGEAYRAKVDGKDGSWDLPLKAEVTAWGREEG
NGNKAEAAQTLVDNNAAVVGFALRALNSDEKYRESVDLGFRCVAQALVDGVESAAPPAVP
QHFSREVAKAAAYLRDKVGVPRDLSYPAARQLRAHLHWLVKALGSELYQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactgcagaggtttctagctgggaagaattgtcggagaaagtatcgagactg
ccgggatacaatgcagtggcagcagctgccaggctcccaaacgttcaacagcgggatttt
ggtgatacaagcatcgcacaggttgttttctacagggacaactcgtcctggtgcccgtat
tgccagagagtgtggctgcagcttgaagaaaagaggattccttacaaggttgaaaagata
aacatgaactgctatggaccgaagcctgcatggtatctcgagaaggtgccttctggactg
cttccagctctagagctcaaaggccagcttttgacagagtctctggacataatgctgata
ctggaagaggcttttccggaacgccatcctcttttgccacccaaaggttctcccaaagcg
aacgccgtggacggcttgctgagactggagcgacttctcgctggcgcgtggctgagcagg
ctgagaagcttttggacgaaaccgggacagttcgaaggtgcaatggacgacgttgatggc
gctcttgcgaagttcggtggtccatttttcctcggtgacacgttttctttggtggacgct
gtttatgctcctttcctagagagaatcgctgccagcatgccttactggcaaggagttatg
atccgaggtgagactcggtggcctcatctgcaggcctggtttgatgccatggacgcgaag
ccaagttatcaggccgtcaagtcggatgactacactataactcacacgttggaacctcaa
ataggagcttgcagagcactcccggctggcgaggcatacagagccaaagttgatgggaaa
gatggaagctgggatttgccactaaaagcagaagtgacagcgtggggacgagaggaggga
aatgggaataaagcggaggcagcacagactcttgttgacaacaacgcagcagtggtcggt
ttcgctctccgggccctcaacagcgatgaaaagtatcgggaatctgtggatttgggattc
cgatgtgtggcgcaagctctggttgacggagttgaaagtgcagctcctcctgccgttcct
cagcatttttccagagaggtggcgaaagccgctgcatatctgcgagacaaagttggtgta
cctcgtgatttgagctatccggcggccagacagctccgagctcatttgcactggctggta
aaggcgctgggatcggagctctaccagtag

DBGET integrated database retrieval system