KEGG   Selaginella moellendorffii: SELMODRAFT_142613Help
Entry
SELMODRAFT_142613 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SELMODRAFT_142613
Enzymes [BR:smo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SELMODRAFT_142613
Chaperones and folding catalysts [BR:smo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SELMODRAFT_142613
Membrane trafficking [BR:smo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    SELMODRAFT_142613
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SELMODRAFT_142613
  Exosomal proteins of colorectal cancer cells
   SELMODRAFT_142613
  Exosomal proteins of bladder cancer cells
   SELMODRAFT_142613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 OST3_OST6 Calsequestrin Redoxin TraF ERp29_N Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 9654103
NCBI-ProteinID: XP_002964632
JGI: 142613
UniProt: D8R0G0
Position
Unknown
AA seq 493 aa AA seqDB search
MAREGVVFLALALLAVTAARVIDASSESSDVLELDDSNFADEIKKHDFIVVEFYAPWCGH
CKKLAPEYEKAATALKEHNIVLAKVDANEEKNKKIASDYEIRGFPTLKIIRKGTVEEYKG
PRDADGIVSYLKKQAGPATVELTSTEEAGDFVGQNKIAIIGVFKSYDSEEFQNFTALAEA
LRSEYDFRHTLDASVLPLKDEPLKAPAVRLFKVFDERFNDFTNFYVEELKKFVEESSLPL
VTELNQDPEMQPFLMKFFNKEAPKVFLFVESSHDEEYRPAYKKVAESNKPKGLLFLAANS
AGNDHALQHFGLAAAKLPSIVVQDAQGKKFAVETIESSKLSSFVDDYLAGKLKPWVKSEP
VPEKNDEPVKVVVRNTLNDLVIESGKDVLLEFYAPWCGHCKKLAPTLDEVAEHFKDDPKV
VIAKLDATANDIEDETFDVQGFPTLYLYTGAKQAVKYEGDRSKEDLISFVDKHRTSAAPS
ATPDAGEPSKDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagagggagtggtattcctggcgcttgcgctgctggcggtcactgctgccaga
gtcatcgatgcgtcgagcgagagcagcgatgttcttgagctcgacgactccaacttcgcg
gacgagatcaagaagcacgacttcatcgtcgtcgagttctacgcgccctggtgtgggcac
tgtaagaagctagctcccgagtacgagaaggcggcgaccgcactgaaagaacacaacatc
gttttggccaaagtagacgcgaacgaggagaagaacaagaagattgcgtcggactatgag
atccggggtttccccaccttgaagatcattcgcaaggggaccgtggaggagtacaagggg
ccgcgcgacgcagatggcattgtgagctacttgaagaaacaagccgggccagccacagtg
gagctaacttctactgaagaggctggagatttcgttggacagaacaagatagctattatt
ggagtttttaagtcttatgatagcgaagagttccaaaacttcacggctctcgcggaagcg
ctcagatctgagtacgactttcgtcacacactggacgcttccgtgctgcctctgaaggac
gagccactgaaagctccggcagtcaggctgttcaaggttttcgacgaacgttttaacgac
ttcacgaatttctatgtcgaggagctcaaaaagtttgtggaggaatcgagcttgcctctt
gtgaccgagctgaatcaggaccccgaaatgcagccgtttctaatgaagtttttcaacaag
gaggcgccaaaggtgtttctgtttgtcgagtcgagccatgacgaagaatatcgacctgct
tacaagaaggttgcagagtcaaacaaaccaaaaggccttcttttccttgctgccaacagc
gcaggaaacgaccatgctcttcagcactttggtcttgcagctgcaaagctgccgtccatt
gttgtacaagacgcacaagggaaaaagttcgcagtagagacgatcgaatcatcaaagcta
tccagttttgtggacgactatttggctggaaagctcaagccgtgggtgaagtccgagccc
gttcccgagaaaaacgatgaaccagtcaaagtggtggtgaggaacactttgaacgacctc
gttatcgagtctgggaaagatgttcttttggaattctacgcgccgtggtgtggccactgt
aagaaactggcgcccacgctggacgaagtcgcggaacacttcaaggatgatcccaaggtc
gtcatcgcgaaactggatgccactgccaacgacattgaagacgaaacgtttgacgtccag
ggcttccccacgctctacctctacacgggcgccaagcaagccgtcaagtacgagggcgat
cgaagcaaggaggatttgatcagcttcgttgacaagcacagaacctcggctgctccttcg
gcgacaccggacgccggcgagccttctaaagacgagctgtga

DBGET integrated database retrieval system