KEGG   Selaginella moellendorffii: SELMODRAFT_148584Help
Entry
SELMODRAFT_148584 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
smo  Selaginella moellendorffii
Pathway
smo00280  Valine, leucine and isoleucine degradation
smo00410  beta-Alanine metabolism
smo00640  Propanoate metabolism
smo01100  Metabolic pathways
smo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SELMODRAFT_148584
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SELMODRAFT_148584
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_148584
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SELMODRAFT_148584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 eIF-5a
Motif
Other DBs
NCBI-GeneID: 9650884
NCBI-ProteinID: XP_002972598
JGI: 148584
UniProt: D8RN96
Position
Unknown
AA seq 370 aa AA seqDB search
MGMPDENQMEEVLVDAHDRVRVMTLNRPQVLNCLNLSVVSRLAELFEQWERDESVELIII
KAAGKVFSAGGDLRMFYDHRKDESWKEVVYKKYWLDYHLYSYRKTRVAIWHGLVVGGGAG
FTFPSTFRIVTENAAFSTPEVAVGFHTDCSASYFLPRLPGHLGEYLALTGSKLDCADMLA
CGIATHFVPSKDVPELEKTLLNLQPESSIQEAIQGFAKMPEAEASSVMKRMTWINSCFSK
DRVEEIIESLASTNDEWCKETARSLRRLSPIALKQALASIRQGRTQSLKKCLEREQRITL
NCLRSLVSDDLYEGIRAVVVDKDRAPKWNPSTLAEVTDDMVEMILNTYTAREQIQLPLEG
EERWSGKYLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgccggacgaaaatcagatggaggaggtgctcgtggatgctcacgatagggtg
cgagtaatgaccctcaatcgccctcaagtgctcaattgtctcaatctctccgttgtctcc
cgactcgcggagctgtttgagcagtgggagagagatgagagtgtggagcttataatcatc
aaggccgcaggcaaggttttctctgctggtggtgacctgcgcatgttctacgatcacagg
aaagacgaatcgtggaaggaagtcgtgtacaaaaagtactggctcgactatcacctgtac
agctacaggaaaacaagagtagctatttggcacggactcgttgtgggagggggagcaggc
tttacgtttcccagcacgtttagaatcgtcactgagaatgctgcattctccactcccgaa
gttgctgtcggttttcatactgattgtagtgcctcgtatttccttccacgacttccagga
catctgggagaataccttgcgctcacaggatcgaaactggactgcgctgatatgctagct
tgtggcatcgctacgcattttgtcccttcaaaggatgttccggagcttgagaagactttg
ctgaatttacaaccggaaagctcaatacaggaggctatccagggatttgctaagatgcct
gaagctgaagcgagcagtgtcatgaaaaggatgacttggataaacagctgcttctcgaaa
gaccgagttgaagagataatcgagtctctggccagtaccaatgacgaatggtgtaaagaa
actgcgcggtcactgaggcgcctctcgccaattgcgctcaagcaagccttagcatcgatc
cggcaaggcaggactcagagcttgaagaaatgcttggaaagagagcagcggattactcta
aattgcttaaggagcctagtctcggatgatctctacgaagggattagagctgtggttgtg
gataaagatcgcgctccaaagtggaatccatcgactcttgcagaagtcacggatgacatg
gtagagatgatcttgaacacctacactgccagggagcaaattcaattgcctctggaaggc
gaggaaaggtggagtggcaaatacttggcctag

DBGET integrated database retrieval system