KEGG   Selaginella moellendorffii: SELMODRAFT_152462Help
Entry
SELMODRAFT_152462 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
smo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_152462
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SELMODRAFT_152462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 FSH1 Abhydrolase_6 Abhydrolase_1 DLH Lipase_3 Esterase Peptidase_S9 DUF2974
Motif
Other DBs
NCBI-GeneID: 9653090
NCBI-ProteinID: XP_002978114
JGI: 152462
UniProt: D8S4L1
Position
Unknown
AA seq 251 aa AA seqDB search
MDAAGSSAVEPSQGKWGKTITIEPEGKHLVTVVWLHGLGDTGHGWASILKTLSLNNIRWI
VPTAPVRPVTINNGYPCTAWFDVGSLSDEGPDDILGLDSSAAYVASFLSKEPADVKVAVG
GFSMGGATSLYTAAHSVLGKYTDGKPFTRKIDAVMSLSGWLPAGKLLPKQVAETPDCLKL
AAELPIFMAHGKNDFIVYHNFGEMSARALKECGFKNVTFKSYRGLDHSTTPEELDDLCEW
IKQELSVPEKV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctggatctagtgcagtggagccgagccaaggaaaatgggggaagacgata
acaatcgagccggagggcaagcatctcgtcacggtagtttggctgcatggtcttggcgat
actggccacggctgggcttccattctgaagactctttctctaaacaatatcagatggatc
gtcccgaccgcgcctgtccggcccgtaaccattaataatggatatccatgcaccgcatgg
tttgatgtgggatcgctctcggacgaaggaccagatgatattcttggcctagattcttct
gctgcatatgttgctagctttctttcgaaggagcctgctgatgtgaaggttgcggttggc
gggtttagcatgggcggcgcaacatctttgtacactgctgctcattcggttcttgggaaa
tacacggatggaaagccatttactagaaagatagacgcagtcatgtctctcagtggatgg
cttcctgctggcaagttgttgccaaagcaagttgctgaaactccagactgcttgaaattg
gccgcggagcttccaattttcatggctcatgggaaaaatgacttcatcgtctatcacaac
ttcggcgaaatgtcggcgcgggcactgaaggagtgcgggttcaagaacgtcacgtttaag
tcttacagagggcttgatcactcgacgacaccagaggagctagacgacctttgcgagtgg
attaaacaagagctcagtgtccctgaaaaagtatag

DBGET integrated database retrieval system