KEGG   Selaginella moellendorffii: SELMODRAFT_158000Help
Entry
SELMODRAFT_158000 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
smo  Selaginella moellendorffii
Pathway
smo00562  Inositol phosphate metabolism
smo01100  Metabolic pathways
smo04070  Phosphatidylinositol signaling system
smo04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SELMODRAFT_158000
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SELMODRAFT_158000
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    SELMODRAFT_158000
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SELMODRAFT_158000
Membrane trafficking [BR:smo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    SELMODRAFT_158000
 Endocytosis
  Macropinocytosis
   Phospholipase C
    SELMODRAFT_158000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 B9-C2 PI3K_C2 FinO_N
Motif
Other DBs
NCBI-GeneID: 9658716
NCBI-ProteinID: XP_002986542
JGI: 158000
UniProt: D8ST03
Position
Unknown
AA seq 510 aa AA seqDB search
MFDEAAGGGTVINAAGMARFLERFQGCDPSLSQSTASEIMSRLAPQGLDLTSFIHKFLLD
PALNAAMLGTKKPSHDMTAPLSHYYIHTSHNSYLKGNQLTSKSCSSPIVLALQNGCRVIE
LDCWEHKGKVMVFHGGTLTRAVPFDVCVASIKEHAFVASEYPVIVTIENHLPPALQQEAA
KILRELVGDALYIPASETPPTEFLSPWELRKKIIISDKPPKEHLAKQRNVTKAAEAMAAA
SLHEEHPEVPKIPELQHLLYIYCAKPSEMKEAPVNGELVSTSTAIMANMSEPQLKKSVLS
NPFSLIQYTKNNLGRMYPFGLRFDSSNADPMLAWSHGFQLAALNLQGKDRPCWVARGFFL
GNGGCGYIKKPDCFLSDVPHDSNVKSTLKVRVLTGTDWHKRFDLFSKPDFYVKVAVHGVA
ADKLKKRTKVAHKTHHPNWETEVFEFPLTVPEIAVLRFEVWEHDRMRRDDFVGQACIPVP
ELEQGIRVVPLHSKRGEPRSSKLLCHFHHQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaggctgccggcgggggcacggtcataaatgccgctggaatggcgcgtttc
ttggagagatttcaaggctgtgacccgagcttgagccagagcacagcgtccgagattatg
tctaggctggcgccgcagggcctggatctcacgagcttcatccacaaatttctcctcgat
ccagcactcaatgctgcaatgcttggcacgaagaagccaagccacgacatgactgctcca
ctctcacattattacatccatacaagccacaactcgtacctcaaaggaaaccagctcacc
tccaaatcgtgctcgtcgcccattgtcttggcgctgcaaaatggctgccgtgtcatcgag
ttggactgctgggagcacaaaggcaaggttatggtcttccatggcggcacgctgacgagg
gctgttccattcgatgtctgcgtagcgtctataaaggagcacgcttttgtagcgtcggaa
tacccagtgattgtcactattgaaaatcatttgccaccggctttacaacaggaagcggcc
aagatacttcgagagctcgttggcgatgcattgtatataccggcttctgagacgcccccg
acagagtttctgtcaccctgggagctcaggaaaaagataatcatctcggacaagcctcca
aaggagcatttagccaagcagcgtaatgttacgaaagctgcggaagcaatggctgccgcc
agtttgcacgaggaacatcctgaagttcccaaaatcccggagctacagcacttgctgtac
atctactgcgccaaaccgtcggagatgaaggaagctcctgtcaatggcgaacttgtctcc
accagcactgcaatcatggccaacatgagcgagccccagctaaagaaatcagtgctctcg
aatccattttctctcatccagtacacaaagaacaacttgggccgaatgtacccgttcggc
ctccgctttgattcctcgaatgcggatccaatgcttgcttggagtcatggatttcagttg
gccgcgttaaacttgcaaggaaaagaccgtccgtgctgggttgctcgaggtttcttcctt
ggaaacggaggctgcggctacatcaaaaaacccgactgctttctcagcgacgtcccacac
gacagcaacgtcaaatctacactcaaggtgagagtcttgacaggcaccgactggcacaag
cgattcgatctcttctccaaaccagatttctacgtaaaggttgcggtgcatggagttgcg
gccgacaagctgaaaaagaggaccaaagtcgcgcacaagacgcatcatccaaactgggaa
accgaggtgttcgagttcccgctaacagtcccggagatcgccgtgctgcgattcgaggtg
tgggagcacgatcgaatgcggagagacgatttcgtggggcaagcttgcatccccgtcccg
gagctggagcaaggaattcgcgttgtgccactccactccaagcggggcgagccaaggagc
tccaagctcctctgccactttcaccaccagtag

DBGET integrated database retrieval system