KEGG   Selaginella moellendorffii: SELMODRAFT_161756Help
Entry
SELMODRAFT_161756 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
smo  Selaginella moellendorffii
Pathway
smo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SELMODRAFT_161756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smo02000]
    SELMODRAFT_161756
Transporters [BR:smo02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    SELMODRAFT_161756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 MMR_HSR1 RsgA_GTPase AAA_16 FtsK_SpoIIIE Zeta_toxin AAA_7 AAA_23 MeaB T2SSE Dynamin_N AAA_21 TrwB_AAD_bind DUF87 CIDE-N
Motif
Other DBs
NCBI-GeneID: 9631886
NCBI-ProteinID: XP_002991601
JGI: 161756
UniProt: D8T7J9
Position
Unknown
AA seq 1467 aa AA seqDB search
MFYLFNPCSQRAIVSVIQLLFLAVFVVLAIIKTASQLRTSRHSSYGKEVTTTKSTKMFHA
TLALASMAGILYAAVDACLLWLKLAREEASVATVDIMFSTIQSFKWLCFVVIVGHEKKFN
ILVHPWTIRSWWVIDFLLSALLFSTAVQRVVLRFDAHLAGNGIVSLVMFPVSIFFLVVAI
RGWTGIVICSSSVAKPLLENGHLEKVVDDGIAEEVLPTTGYATAGVFNRAVWKWLTPLLD
KGYKSPLQLHDIPLLAPDDRAESNYSRFKRDWPENDPGSHPVRSTLLKCFGGILFRNGLL
ALIRLCVMYAGPILIQRFVSYTANAYQGPAYEGYLLVLVLLIAKVIEVFSSHQYNFQSMK
LGMMVRSTIIAAVYQKGLRLSSSSKQGHGVGHIVNYMVVDAQQLSDLMYQLHNLWVLPAQ
VCIALAILYGVMGLPMLAGFFVMAIIIALNFYYTKKQREHQTKLMAMRDERMKATSEVLN
FMKIIKFQAWEDHFLGRVEGYRMREYTSLRKFLIVLAQNIAALWMCSSLVATVTFAACVV
FNVELTAAKVFTATATFRILQEPVRAFPQALISISQSLVSLERLDKYMVSDELDTKAVEK
LPADADAAVDVEDGTFSWEEDEPTLKDINVHVKKGQLVAIVGTVGSGKSSMLTALLGEMR
KLSGKVRISGSTAYVPQTAWIQNATIEDNILFGLPMDKARYAAVVRSCALEQDFKLMEFG
DQTEIGERGINLSGGQKQRIQLARAVYQDSDIYLLDDVFSAVDAHTGTHLFQECILGYLR
KKTVLLVTHQVEFLHHADLVLVLRDGTIVQSGKYSELLEKGTDLEVLVAAHHSAMESISM
DEQDVVTDLPLEATQERKLSFKRRPSIREPRQPQKLKGSAKLIDEEQREAGRVGWRVYWL
YFTKAFGWPTLPIIVSCQGLWTVVSIASDYWLAAETAKTSFSAAAFVKVYLVLSAISWVL
VIGRVSFQTVAGLKAAQMFYFDMLRSIFRSPMSFFDTTPSGRILSRSSTDQAQLDVLVPF
FVSGTIATFLGTLGSVIVACQVTWPLIFLILPLAWAFLFYQNYYITTSRELTRLDSISKA
PVIFHFSETLAGLPTIRAFKKQESFIDGNVDRVNTNIRMEFHNIASNEWLGLRLELLGTI
VLCASALLLVTLPASIIAPENVGLALSYGLVLNSSLFWSVWIACMLENKMVSVERIRQYT
TIESEAPRINDDYRAPLIWPSQGTVAVRNLQLRYRPNTPLVLKGVTLTIQGGDKVGVVGR
TGSGKSTLIQAFFRLVEPCGGEVRIDGIDITQLGLADLRSRFGIIPQEPILFEGSIRSNV
DPLGQYSDDRIWEVLRKCQLADAVQQKTGGLDSSVVDNGDNWSVGQKQLFCLGRALLKDS
RLLFLDEATASVDAQTDAVIQKTIREQFASSTVVSVAHRIPSVMDSDKVLVMGEGEVKEY
DRPSVLLERPTSLFAALVREYSARSGV
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgttctatctcttcaatccctgctcgcaacgggcgatcgtttccgtgatccagctcctc
tttctagcggtgttcgtggtgctggcaatcataaagacggcctcgcagcttagaacatca
cgacactccagctatgggaaagaggtgacgactactaagtccacgaagatgtttcacgca
actctggctctcgcatctatggcgggcattctctacgccgccgtggatgcttgtctgctc
tggcttaaactggcccgcgaagaagcttcggttgctacagtcgacattatgttttccacc
atacagagtttcaagtggctctgctttgtcgtcatcgttggacacgagaagaagtttaat
atccttgtccacccttggacgattcgatcctggtgggtgattgattttttgttgtcagcc
ttgcttttctctactgcagtgcagagagtagtactaagattcgatgctcaccttgctggc
aatggcatcgtctcgctggttatgttcccggtttctatattctttctcgtggtggctatc
cgaggctggacaggcattgtcatttgttcttcgagcgtggccaaaccactgctggagaac
gggcatttggagaaagttgtggacgatggcattgctgaagaggtccttcctacgacgggg
tacgctactgccggggtcttcaacagggccgtgtggaagtggttgacaccgctgctagac
aagggatacaagagtccgctccaactccatgatattccgctgctggcacccgacgacaga
gctgagagtaactattcgcgttttaagagggactggccagagaacgacccgggcagccat
cctgtgagatcgacgttactaaaatgctttggcggcattctctttcgcaacggactgctg
gctttgatcaggctttgcgtcatgtacgctggtccgattctcattcagaggtttgtcagc
tataccgcaaatgcttatcaaggcccggcttacgaaggataccttctcgtcctggttttg
ctgatcgctaaagtcatagaggtgttctcgtctcatcagtataacttccaaagtatgaag
ctgggaatgatggttcgctcgacgattatcgctgctgtttaccagaaaggccttcgtctc
tcgagctcgtccaagcagggtcatggagttggccacattgtgaattacatggtggtggat
gctcagcagctctcggatctgatgtaccagctccacaacctctgggttcttccggcacaa
gtttgcatagctctcgccatcttgtacggagttatgggattgcctatgctagccggcttt
tttgtcatggcgattattatcgccctcaacttttactacacaaagaagcagcgagaacac
cagaccaaactcatggccatgagagacgaacggatgaaagctacgagcgaggttctcaac
tttatgaagatcatcaagttccaggcgtgggaggaccactttctaggccgagtcgagggg
tacaggatgagggagtacacatctctacgcaagttcctaatcgtccttgctcagaatata
gcagccctgtggatgtgttcttcgctggtggcgacggtaacttttgcggcttgtgtggta
ttcaacgtcgagctaactgccgccaaagtttttacagccaccgcaacttttcgcatactg
caagagcctgtccgagcatttcctcaggcactcatctccatctcgcaatcgctggtgtcg
ctagagcggctggataagtacatggtcagtgatgaactggacacgaaagctgtggagaag
ctaccagcggatgccgatgctgccgtcgatgttgaggacgggacgttttcctgggaagag
gatgaacccacgctgaaagatatcaatgtccacgtgaagaaaggccaacttgtagcaatt
gttgggactgtgggatccggaaagtcatcgatgctgacggctttgcttggagaaatgcgc
aagctgtcgggaaaggtaagaatttccggcagcacggcctacgttccacaaactgcctgg
atacaaaacgcgacgattgaagacaacattttgttcggcttgccaatggacaaggcgaga
tacgctgcagtagtccgttcgtgtgccttagaacaggacttcaaactcatggagttcggg
gaccagacggaaattggagagcgaggtatcaatctcagcggtgggcagaagcagcgcatt
cagctggccagagctgtgtaccaagactcggacatttatttgcttgacgatgtcttcagt
gctgtggacgctcacactggcacgcacttgtttcaggaatgtatacttggatatttgcga
aagaagacggtgttgctggttacgcatcaagttgaatttttgcatcacgccgacttggtt
ctggttctgcgcgatggcacgattgttcaatctggcaagtactcggaactcttagaaaaa
ggaacggacttggaagttttagtagctgctcatcacagcgcaatggaatcaattagcatg
gacgagcaagatgttgttactgatctccctctcgaggctactcaggaacgaaagctgtca
ttcaaacgaaggccttcgataagagagccccgtcagccgcagaaactaaaaggctcagcc
aagcttatcgacgaggaacaaagagaagccggacgagtcggatggagggtctactggctg
tacttcaccaaagcattcggctggccaacactccccattattgtgtcgtgtcaaggattg
tggacagtggtgagcatcgcaagtgactactggcttgcggcagaaacggcgaagacgtct
ttcagtgcggccgcatttgtgaaagtttacttggtcctcagcgcgatatcctgggttttg
gtgataggaagagtatcgtttcagacagtggcgggattgaaagcagcacagatgttctac
ttcgacatgttgcgcagcatttttcgaagtccaatgtctttctttgacacaacgccgtcg
ggaagaattttgagcagatcgtctactgatcaggctcagcttgacgtgctcgtgccgttt
tttgtatcaggaaccatagcgactttcttgggaactcttggttctgtgatagtggcatgc
caagttacgtggccactgatttttctcatactgcctcttgcttgggctttcctcttttac
cagaattactatatcacaacatctagagaacttactcgtttggattctatctctaaagct
ccagtcattttccacttctccgagacattagcaggactgccaactatccgtgcgtttaag
aagcaagaaagctttattgatggcaatgtggacagggtaaacaccaacatacgcatggag
tttcataacattgcctcgaacgagtggcttggattgaggctagagctgctcggcacaatc
gttctctgtgcatcggctttgttgctcgtgactcttccagcgagtattatcgcacctgaa
aatgttggtctcgccctatcgtatggattggtgctcaattcgtccttgttctggtcggtg
tggattgcatgcatgctggagaacaaaatggtttctgtagaaagaatccgacagtacact
accatcgaaagtgaggccccgaggataaatgacgactacagggcccctctaatatggccc
agccaaggaactgtagctgttcgaaacttgcaacttcggtatcggccaaacactcctctc
gtcttgaaaggagtaaccttgactatccaaggaggagacaaagttggcgttgttggtcga
actgggagtggaaagtcgacgctgattcaagccttcttcaggctggtagagccgtgtggg
ggcgaagttcgaattgacggcattgacatcacacagctcggactagctgacctgaggtcc
cggtttggaatcataccccaggagcccatactgttcgaaggcagcataagaagcaacgta
gatccacttggccagtactcggacgatcggatttgggaggttctaagaaagtgtcagctg
gcggatgctgttcaacagaaaactggagggctcgactcatctgtggtggataatggcgat
aactggagcgttgggcagaagcagctcttctgcttgggacgggcattgctgaaagacagc
cggctcttgttcctggacgaggcaactgcatccgtggacgcacagacggacgcggtcatc
caaaagacgatccgcgagcaattcgcgtcgtcgacagtggtgagcgtggctcacaggatc
ccgtctgtgatggacagtgacaaagttttggtgatgggcgaaggagaggtgaaagagtac
gatcggccgtcagtgctgctcgaacgaccaacgtctttgtttgcagcactggtccgtgaa
tactcggcacgctctggtgtgtag

DBGET integrated database retrieval system