KEGG   Selaginella moellendorffii: SELMODRAFT_164132Help
Entry
SELMODRAFT_164132 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smo01001]
    SELMODRAFT_164132
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SELMODRAFT_164132
Protein kinases [BR:smo01001]
 Serine/threonine kinases: TKL group
  IRAK family
   SELMODRAFT_164132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRR_8 LRR_4 LRRNT_2 Ciart M-factor
Motif
Other DBs
NCBI-GeneID: 9641973
NCBI-ProteinID: XP_002960437
JGI: 164132
UniProt: D8QMR3
Position
Unknown
AA seq 621 aa AA seqDB search
MDLLPPLLRLWPPPLLLPLLLVLVGFIHCQTDLECLSEFRLSVIDQSGYLSSWSANSSSS
SSICNAVGVQCLHPSEAKIYSLSLRAAGLSGSFPRGLDKCSSLTGLDLSGNSFSGAIPAD
LCKSLPFLVRLDLSGNDFSGSIPGELSQCQYLNALDLQQNHLTGSVPGQLGVLPRLTELH
LEGNQLSGEIPPILASRPAANFQFQDNAGLCGPPLSKSCGGGSKASAGIIAGTVVGGAVI
LLAITAVAFYLSRRPKTMRDDTTWAKKIKAPRSITVSMFEQFLVKIKLSDLMAATESFSR
DNVIDAGSAATGVAYRATLRDGSVLAVKRLAPAPRASSSDAAQFQAEVEALGLVRHANLV
PLLGYCVTGGERLLLYKHMTNGTLWSWLHDAHGTRDRLDWPARLKVALGASRGMAYLHHG
CNPRILHRSLSTHTILLDDDFDARITDFGLARIVAPAGGHLNADVLTAGGTVGDPGHDAP
EYRRVPITTAKGDVYSFGVVLLQLLTSQKPLDVTVGDFNGSLVEWVGALYASGRSGDAID
KSLSGGAADDGELLQALKIACGCVLYAPNDRPSMLEVFEQLRKIGERYDFTDEGDEIPIA
AAASDETAATQQRSNGNGASL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttaccgccgctgctaagattgtggccgccgccgctcctactgccactgctc
ctcgttcttgtgggtttcatccactgccagaccgacttggagtgcctcagcgagttccgc
ctctcggtcatcgatcaatcgggctacctgagctcctggtctgccaacagcagctccagc
agctccatttgcaacgctgtgggcgtccagtgcctccacccatccgaggccaagatctat
tccctatccctccgcgccgccggcctctcgggctccttcccccggggtctcgacaaatgc
tccagtctcacgggcttggatctctcgggcaactccttctcgggcgccatccccgcggac
ctctgcaaatcgctgcccttcctcgtccgcctcgacctctcgggcaacgacttctccgga
tcgatccccggggagctctcccagtgccagtaccttaacgccctggatttgcagcagaac
cacctcactggcagcgtccccgggcagctcggtgttcttccgcgcctcacggagctccac
ctcgagggcaaccagctcagcggcgaaatcccgcccatcctcgcaagtcgccccgcggcg
aatttccagttccaggacaacgccgggctgtgcggtccgccgctctccaagagctgcggc
ggcgggtcgaaggccagcgccgggatcattgccgggactgtggttggcggcgcggtgatc
cttctcgccatcactgccgtggcgttctacttgagccgccggcccaagacgatgcgcgac
gacaccacctgggccaagaagatcaaggcgccgcgcagcatcaccgtgtccatgttcgag
cagttccttgtcaagatcaagctctcggatctcatggccgccaccgagagcttctcgcgg
gacaacgtcattgacgccggaagcgccgccaccggggtggcgtaccgcgcgacgctccgg
gacgggtccgtgctggcggtgaagcgcctggcgcccgcgccgcgcgctagtagcagcgac
gccgcacagtttcaggccgaggtggaggcgctgggcctggtccgtcatgctaacctggta
ccgctactcgggtactgcgtcacgggcggcgagcggctcctcctgtacaagcacatgacc
aacggcacgctgtggagctggctgcatgacgcccacggcacgcgggaccggctcgactgg
cccgcgcggctcaaggtggcgctgggcgcgtcgcgcggcatggcttacctccaccacggc
tgcaacccacggatcctccaccggagcctcagcacgcacacgatcctcctggacgacgac
ttcgacgcgaggatcacggactttgggctagcccggatcgtggcgcccgcgggcggccac
ctcaatgcggacgtgcttaccgccggcggcacggtgggtgacccgggccacgacgcgccc
gagtaccgccgggtgcccatcactaccgccaagggcgacgtgtacagctttggcgtcgtg
ctactccagctgctaacgagtcagaagccgctggacgtgacggtgggcgatttcaatggg
agcttggtggaatgggtcggggcgctctacgcgagtgggaggagcggcgacgccatcgac
aaatcgctcagcggtggcgctgccgacgatggggagctgctccaggcgctcaagatcgcg
tgtgggtgcgtgctctacgcgcccaacgatcgcccatccatgctcgaggtgttcgagcag
ctgaggaagatcggggagaggtatgatttcactgacgagggcgatgagatcccgattgcc
gcggctgctagcgatgagacagcggcgacgcagcagcgatccaacgggaatggggcgagc
ttgtga

DBGET integrated database retrieval system