KEGG   Selaginella moellendorffii: SELMODRAFT_164891Help
Entry
SELMODRAFT_164891 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smo  Selaginella moellendorffii
Pathway
smo00450  Selenocompound metabolism
smo00970  Aminoacyl-tRNA biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SELMODRAFT_164891
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SELMODRAFT_164891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smo01007]
    SELMODRAFT_164891
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smo03016]
    SELMODRAFT_164891
Enzymes [BR:smo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SELMODRAFT_164891
Amino acid related enzymes [BR:smo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SELMODRAFT_164891
Transfer RNA biogenesis [BR:smo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SELMODRAFT_164891
 Prokaryotic type
   Other AARSs
    SELMODRAFT_164891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Hormone_recep tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 9630502
NCBI-ProteinID: XP_002961572
JGI: 164891
UniProt: D8QRU7
Position
Unknown
AA seq 784 aa AA seqDB search
MAKLPCAGRRNILVTSALPYVNNVPHLGNIIGSVLSADVFARYGRLRGYNIIYMCGTDEY
GTATETKALEEKTSPKEICDKYHDVHKKVYDWFDIRFDKFGRTSSPEQTVICQSIFKKLL
AQDRLYEDKINQACRLYCESCQRFLADRFVIGTCPKCGMTARGDQCEKCTHVLNPGELVE
PKCKICNSSPHLRETTHLFLDLPKIKNELVDYVEKTSIAGGWSSNSITITNAWIRDGLKG
RCITRDLKWGVPVPLPRFEDKVFYVWFDAPIGYISITANYTPEWEQWWKSEDVELFQFMG
KDNVTFHTVIFPCTLLGTGERWTMMKTLSATEYLNYEGAKFSKSAGIGVFGNDAQDTNVP
VEVWRYYLLSIRPEAADTFFSWADLQAKQNNELLKNLGNFVHRCLSFLAKPEGQGYGSKI
PDAPGAEEHALTVKLAEEVSELLQQYVDSMEKTKLKNGLKVAMSISSLGNSYLQESEFWR
LYKEDRPSCNIVVRTAIGLVKILATILEPFMPSFSKKVASQLGLDLSDLSLIDADVEAFR
TPWVLLRDGHVIGQPDTIFFEMSDEEVQAYRKRFAGSQAERACSEEAAKKADVKAKADIK
TKADAKPKKKNATVNAADVKTPVDIRLADIRVGRIVKVAKHPNADSLYVEEIDVGEDTPR
TVVSGLVKFIPLEEMENRRVCVICNLKPAKMRGVLSQAMVLAASNKEETKVELVEPPEGA
VIGERVTCPGYEGDADAVLKPKDWAVVQPDLQTSSELIAVYKGAPFSTTGGVCKVASLAS
GSIK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctgccgtgcgcggggcggaggaacatcctcgtcacatcggcgctgccatac
gtgaacaacgtgccgcatctcggaaatatcatcggatctgtgctgagcgccgacgtcttc
gcgagatatggccgactgcggggctacaatatcatctacatgtgtgggacggatgaatac
ggcacagcgactgagactaaggccctggaagagaagacgagcccaaaggagatttgtgac
aagtaccacgacgtgcacaagaaagtctatgactggtttgatatccgattcgataagttt
gggagaacgtctagccccgagcaaactgtgatctgccagtcgattttcaagaagctgctt
gcgcaagataggctttatgaagacaagattaatcaggcatgtagactttactgcgagtct
tgccagcggtttcttgctgataggttcgtcattggcacttgtcccaagtgtggaatgacg
gccagaggtgaccaatgcgagaagtgtacgcacgttctaaacccgggggagcttgtcgaa
ccaaagtgcaagatttgcaacagtagtcctcatttaagagaaacaacgcatctgttcctt
gatctgcccaagataaagaacgagctggtggattacgtcgagaaaacatctatagctggt
ggttggagttcaaactctattacgatcacgaatgcatggatccgagatggcttgaagggc
agatgtataacgcgcgatctgaagtggggagttccggttcccttacccagattcgaggac
aaggtgttctacgtctggtttgatgctcctattggctacatttcgatcactgcaaactac
actcccgaatgggagcaatggtggaagtcggaagatgttgagctttttcagttcatgggg
aaagacaatgtgacgtttcacacggtgatttttccttgcaccttgttgggaacgggcgag
cgctggacgatgatgaaaacattgagtgccacagagtatctgaattatgaaggagctaag
ttttcaaagagtgcgggcattggagtttttggcaacgatgcacaggatacgaatgttcct
gttgaagtctggagatactatcttctctccattcgtccagaggctgccgatacgttcttc
agctgggccgacttgcaggctaaacaaaacaatgagctgttaaaaaaccttgggaatttc
gttcacaggtgtctgagcttcttagcaaaacctgaaggccaaggatacggttcaaagata
cctgatgctccgggtgcagaggagcatgcgctgaccgtgaaacttgcagaagaagtgtca
gagcttcttcagcaatacgtagattcgatggagaagacgaaactcaaaaacggactgaag
gtagcgatgagcatttcaagccttggcaattcttacttgcaagagtcggaattttggcgc
ctctataaagaagaccgcccgtcttgcaatatagttgtaaggacagcaattggtcttgtt
aagattttggcgaccattctcgagccgttcatgccatccttttcaaagaaggtcgcatca
caattaggattagacttatccgatctttcgctcattgatgcggatgtggaggctttcagg
actccctgggttctcctccgagatggtcatgtcattggacaacccgatacaatattcttt
gagatgagtgacgaggaagttcaggcgtaccgtaaaaggtttgctgggtctcaggctgag
cgtgcctgctcggaagaagcagcaaagaaagcggacgtcaaagcaaaagcagatatcaag
acgaaggctgatgccaaaccgaagaaaaagaacgctactgttaacgccgctgatgttaag
acacctgtggacattagactggctgatatcagagtaggcaggatcgtcaaagttgcaaag
cacccgaatgcagattctttgtatgttgaagaaattgacgtcggtgaagacactccgagg
acggttgttagcggtctggtgaagttcataccactagaggagatggagaatcggcgagtt
tgcgtcatctgtaatctcaagcctgcgaagatgcgaggagtgctgtctcaagcgatggtt
ctggcagcttcaaacaaggaggagacaaaggtggaactggtagagcctcctgaaggtgct
gttatcggcgagagagtaacctgtccggggtatgaaggcgacgctgacgctgtgctcaag
cctaaagactgggcagtcgtacagcctgatttgcagacaagcagtgagctgattgcagtg
tacaagggagcaccattctcaaccactggtggagtttgcaaggtggcatccctcgcaagc
ggctccatcaagtag

DBGET integrated database retrieval system