KEGG   Selaginella moellendorffii: SELMODRAFT_171292Help
Entry
SELMODRAFT_171292 CDS       T01496                                 

Gene name
NDPK1-1
Definition
(RefSeq) hypothetical protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
smo  Selaginella moellendorffii
Pathway
smo00230  Purine metabolism
smo00240  Pyrimidine metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo04016  MAPK signaling pathway - plant
Module
smo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
smo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
smo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SELMODRAFT_171292 (NDPK1-1)
   00240 Pyrimidine metabolism
    SELMODRAFT_171292 (NDPK1-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    SELMODRAFT_171292 (NDPK1-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_171292 (NDPK1-1)
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SELMODRAFT_171292 (NDPK1-1)
Membrane trafficking [BR:smo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SELMODRAFT_171292 (NDPK1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 9631996
NCBI-ProteinID: XP_002970181
JGI: 171292
UniProt: D8RHN0
Position
Unknown
AA seq 151 aa AA seqDB search
MATMEQSFIMIKPDGVQRGLVGEIIARFEKKGFTLKGLRLMQIEKSFAEKHYADLSAKPF
FGGLVEYVTSGPVVAMVWEGKGVVETGRKIIGATNPAASAPGTIRGDFAIDVGRNVIHGS
DSVDNAKKEIALWFPDGVVDWQKSVHPWIYE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatggagcagagcttcattatgatcaagcccgatggcgtgcagcggggattg
gttggggagatcattgcgaggtttgagaagaagggattcacgctcaaaggactgaggctg
atgcaaattgagaaatccttcgcggagaagcactacgcggatctctcagcgaagccattc
tttggtggtctcgtcgagtacgtgacttctggccctgttgttgcgatggtgtgggaaggg
aaaggtgtcgtggagaccggccggaagatcatcggagccacgaacccggctgcctcggca
cccggaaccatccgaggggacttcgccatcgacgttggaaggaatgtgatccatggcagc
gactcggtcgacaatgccaagaaggagatcgcactgtggttccccgatggtgtcgtagat
tggcagaagtctgtccacccatggatctacgagtga

DBGET integrated database retrieval system