KEGG   Selaginella moellendorffii: SELMODRAFT_172412Help
Entry
SELMODRAFT_172412 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
smo  Selaginella moellendorffii
Pathway
smo00330  Arginine and proline metabolism
smo00360  Phenylalanine metabolism
smo00380  Tryptophan metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SELMODRAFT_172412
   00360 Phenylalanine metabolism
    SELMODRAFT_172412
   00380 Tryptophan metabolism
    SELMODRAFT_172412
Enzymes [BR:smo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     SELMODRAFT_172412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 9640662
NCBI-ProteinID: XP_002972019
JGI: 172412
UniProt: D8RLK4
Position
Unknown
AA seq 502 aa AA seqDB search
MAFLLTVAVLLAACSLSGTRSPILEASVEEIQQAFRSGSLTSREIVGFYLDRIVHLNPTL
NGVIQLNPDALALADEADAQRRQSSAVAQGLHGIPVLLKDSIATADRMGTTAGSLALLGS
KVPRDAGIVARLRRAGAIILGKTNLSEWMNFRSTNSTSGWSALGGQTKNPYNLDESPCGS
SSGSAVAVAANMVSVSVGTETDGSILCPSSVNAVVGIKPTVGLTSRAGVIPISHTQDTVG
PMCRSVADAVAVLDAIAGADPRDRQTLFISKYIPRGGYKQFLRRDGLRGKRLGIAPVPFF
QGIREDEIAAVDKMISIAKSRGAVIVENLTLPHADEILSGVSEDLVLRTNFKVELNQYLA
QLVKSQVRSLEDVIKFNIQHADKEMKLFGQEIFLESQATKGTHSKDYKEAVKRNQFLTKH
GIDHLFETHKLDALIGAMPSLMTAPAAIAGYPAITIPAGYLSSTGVPFGIGILGTKGSEP
TLIEIAFDLEQATLVRKPPPSM
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcttactcaccgtcgcggtgctgctcgcggcgtgctctctctccggcactcga
tcgcccatcctagaggcgagcgtggaagaaatccagcaggccttccggtccgggagcctc
acctcgcgcgagatcgtcggcttctacctggatcgaatcgtccacctcaatcccacgctc
aacggagtcatccagctcaaccccgacgctcttgccctggccgatgaggcagacgcacag
aggcggcaaagcagcgcagttgctcaggggctccatggaatcccagtgctgctcaaggac
tccatcgccactgccgataggatgggcaccactgcgggctctctggccttactgggctcc
aaagttcctcgggacgctggcattgtggccaggctccggagggccggagcgatcattctt
ggcaagaccaacctcagcgaatggatgaactttcgatccacaaactccaccagcggctgg
agtgcgcttggcggtcagacaaagaatccttacaatctggacgaaagcccgtgcggatcc
agcagtggctccgcggtggcggtagcggccaacatggtttcggtctcggtagggaccgag
acggatggatcgatcctctgcccctcaagcgtgaatgcggtggtgggaatcaagcccacg
gtcggcctcacaagccgagctggcgtcatcccaatctcgcacacccaggatacggtcggg
ccgatgtgccggagcgtggcggatgccgtggcggtgctggacgccatagccggagccgac
ccgagagaccggcaaactctattcatttccaaatacatccctcggggaggatacaagcag
ttcttgaggcgggatgggcttcgcggtaagcggcttggcattgctcctgttcctttcttt
cagggaatccgggaggacgagattgccgccgtagacaagatgatctcaatcgccaaatct
cgtggagcggtgattgtcgagaacttgacgctccctcacgcagatgagatcctctcgggc
gtgagcgaggatctggttcttcgtacgaatttcaaggtggagctcaaccagtaccttgct
cagctcgtcaagagccaggtccggagcctcgaggacgtgatcaagttcaacatccagcac
gctgacaaggagatgaagctctttggccaggaaatattcctcgagtcacaggcaaccaaa
ggcacgcattccaaggactacaaggaggccgtcaaacgaaatcagttcctcacaaagcat
gggattgatcatctttttgagacgcacaagctggatgcgctgatcggagcaatgccatct
ctcatgactgctcctgcggcgattgctggctatcctgccatcaccattcctgcgggatac
ctctcctccacgggcgttccatttggaattggaattctgggaaccaaaggctctgaacca
actcttatagagattgcttttgacttggagcaggcaacccttgtccgaaaacctccacct
tcgatgtaa

DBGET integrated database retrieval system