KEGG   Selaginella moellendorffii: SELMODRAFT_173909Help
Entry
SELMODRAFT_173909 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smo  Selaginella moellendorffii
Pathway
smo00071  Fatty acid degradation
smo00072  Synthesis and degradation of ketone bodies
smo00280  Valine, leucine and isoleucine degradation
smo00310  Lysine degradation
smo00380  Tryptophan metabolism
smo00620  Pyruvate metabolism
smo00630  Glyoxylate and dicarboxylate metabolism
smo00640  Propanoate metabolism
smo00650  Butanoate metabolism
smo00900  Terpenoid backbone biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01212  Fatty acid metabolism
Module
smo_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SELMODRAFT_173909
   00630 Glyoxylate and dicarboxylate metabolism
    SELMODRAFT_173909
   00640 Propanoate metabolism
    SELMODRAFT_173909
   00650 Butanoate metabolism
    SELMODRAFT_173909
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_173909
   00072 Synthesis and degradation of ketone bodies
    SELMODRAFT_173909
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SELMODRAFT_173909
   00310 Lysine degradation
    SELMODRAFT_173909
   00380 Tryptophan metabolism
    SELMODRAFT_173909
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELMODRAFT_173909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smo04147]
    SELMODRAFT_173909
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SELMODRAFT_173909
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELMODRAFT_173909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 9657075
NCBI-ProteinID: XP_002974156
JGI: 173909
UniProt: D8RSP9
Position
Unknown
AA seq 409 aa AA seqDB search
MAIDSGAPSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDP
ALVQEVFFGNVLSANLGQAPARQAAMGAGLPPSAVCTTINKVCASGLKATVLAAQSIQLG
LNDVVVAGGMESMSNTPYYLPKARQGYRMGHGEVIDGMMKDGLWDVYNDYGMGVCAEICA
EQHTISREQQDNYAVQSYERAIAAHTAGAFEWEIVPVEVPGGKGRPSTIVSKDDGIDKLD
AAKLKKLRPAFKEGGSVTAGNASSISDGAAALVLVSGAKALELGLKVIAKIIGYGDAEQS
PELFTTSPALAIPKAIKHAGIDPSQVEYYDINEAFAVVALANQKLLNLDPEKVNVIDGAV
SLGHPLGCSGARILVTLLGVLKHKNGRYGVAGICNGGGGASALVIQSLM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgacagcggcgcgccttccgagtcttcgccgatcgggcccagggatgcgtgc
attgtcggcgtggcgaggacgccgatgggcggcttgagcggatctctctccgccctggct
gctaccaagctcggatctatcgcgatccaaggggcgatcgcgagggcggggatcgatcca
gcgctggttcaagaggttttctttggcaatgtgttgagcgccaacctcggccaagctccc
gccaggcaggctgccatgggtgctggcttgcctccttccgctgtttgcacgacgatcaac
aaggtgtgcgcgtctggattgaaagcgactgttcttgctgcgcaaagtattcagctggga
ttgaatgacgtggttgtcgccggaggcatggagagcatgtctaatactccctattatctt
ccgaaagcaaggcagggatatcgaatgggtcacggggaagttatcgacggcatgatgaaa
gatggtctttgggacgtgtataatgactatggaatgggagtgtgtgcggagatatgtgct
gagcagcacacgatctcaagggagcaacaagataattatgccgttcaaagctatgagaga
gcgatcgcagcgcacacggcgggtgccttcgagtgggaaatcgtcccggtcgaggtcccc
ggagggaaaggaagaccgtctacaattgtttccaaggacgatggaattgacaagcttgac
gcagccaagcttaagaaattgcgtccagctttcaaggaaggtggttctgtgactgctggc
aatgcatccagcatcagcgacggtgctgcggcactcgtgctcgtaagtggagcgaaggca
ttggaacttggactgaaagttattgccaagataattggctatggtgacgctgaacagtct
cccgagctcttcaccacgtcaccagctcttgcgattccaaaagctatcaagcacgccggc
attgatccatctcaagtcgaatactacgacatcaacgaagcgtttgcagtggttgctctc
gcaaaccagaagctcctcaacctcgatcccgagaaagtgaacgtcattgatggtgctgtc
tcccttggccatcctctgggatgtagtggtgctcgcatcctcgtaacactccttggagtt
ctcaagcacaagaatggacgctatggagtggccggaatttgcaatggtggcggtggagcc
tcggctctagtcatccaatctctcatgtaa

DBGET integrated database retrieval system