KEGG   Selaginella moellendorffii: SELMODRAFT_174907Help
Entry
SELMODRAFT_174907 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
smo  Selaginella moellendorffii
Pathway
smo00511  Other glycan degradation
smo00600  Sphingolipid metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SELMODRAFT_174907
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SELMODRAFT_174907
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SELMODRAFT_174907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 9629603
NCBI-ProteinID: XP_002975349
JGI: 174907
UniProt: D8RWH2
Position
Unknown
AA seq 916 aa AA seqDB search
MGLPALAWKRRLDTPVMELKEFKPTFREILEMLPMGVRLWKFCRSEHEQGRRAPIDPFYP
QDTPASSCQGVPLGGIGGGSIGRGFRGDFSRWQLLPTVCQTSAVLADQFSVFITRHSKDG
TTQKTSSVLFPGEPVFESEETESGISSWNWNLTGVKSTYYGLFPRAWTTYDGEPDPQMKI
TCRQVSPFLPHNYKESSFPSCVFIYELVNTGDEDATATLLFTWANSIAGGSETSGGHENS
PFMKEEHSVTFAIAARETDDVSTSVCPCFLVAGAPEGNSYQTAKDMWSEIIEKGCFNAKN
STMSASLSQPETVVGAAVAASVVVPAHGTKSITFGLAWDSPKATFLGGSSYYRRYTKFYG
KSGNAASKLVHDAILNYKRWESEIHAWQEPILNDHSLPEWYRYTLFNELYYLVAGGTIWT
GMNMKRIYTTLLCDLSFSDSCRQACLAQKLNPVKSNGVSEALLDAINANSEAQSFWSFDI
PAVEDNVGQFLYLEGVEYHFWNTYDVHFYASYALLALFPRLELQLQRDFAAATLSHDPEK
MFYLAYGNTGIRAVFGSVPHDLGTHDPWNTLNSYNLYDTSKWKDLNCKFVVQVNRDAAAT
GDLDFARAVWPAAYAAMAFTDQFDRDGDGMIENDGVPDQTYDLWTVDGVSSYCGGLWVAA
LQAASALADLVGDKPSSRMFHDKFLRAKAVYEKSLWNGSYFHYDKNSTSVQSDQLAGQWY
SLASGLPGIVREDQATSALGTVFATNVMRYKGGNEGAVNGMLPSGGEDRTSLQSREVWVG
TTYAVAAAMIQQGMREEGFRTAKGVFLNGWSDQGHGYAFQTPEAWDNDGKYRSLAYMRPL
SIWAMQWALDPPEQLKQRSCNVEVGDITAQEVEACNKSFAKLASQLKELSPPETKAYSSV
WIWMFDYIRSRVYPRG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggggctgccagcactggcgtggaagcggaggctggatactcctgtgatggagctcaag
gagtttaagccaactttcagagaaatactcgagatgctgccgatgggtgtccggctgtgg
aagttttgcagaagtgagcacgaacaaggacggagagcgcctatcgatccattctaccct
caagatacgccggcttcttcgtgccaaggtgttcctctcggtggaattgggggaggaagc
attggtagaggtttccgaggtgatttttcacgatggcaactgcttccaaccgtttgccag
acttctgctgttctagctgatcagttctcggtttttatcacccggcacagtaaagatggc
acaacgcaaaagacctcatcagtgttgtttcctggtgagccagtttttgaaagtgaggag
actgaatccgggatttcttcttggaactggaatctaactggggtaaaaagcacttattac
gggttattccctcgtgcctggacaacttatgatggagaaccggatcctcaaatgaagatt
acatgccgccaggtttcgccattcttaccacacaactacaaagaaagtagttttccttct
tgtgtcttcatctatgagctggtaaatacaggagatgaagacgcgacggctacgctgcta
tttacgtgggctaacagcattgctggaggatcggaaacatctggaggccatgaaaattct
cctttcatgaaagaagagcactctgtgacgttcgctattgcggcaagggaaacggacgat
gtttccacatcagtctgtccttgttttctagttgctggtgccccggagggaaattcttat
caaacggcgaaggatatgtggagtgagataatagagaaaggatgctttaatgcgaagaat
tcgacgatgtccgcttcgttgtcgcaaccggaaaccgttgtgggagctgctgttgccgca
agtgttgttgttccagcacacggaacaaaatccatcacctttggactggcatgggattca
cctaaagctaccttcttgggtggtagctcctactacaggaggtacacgaagttttatggg
aagtctggcaacgctgcatcgaagcttgttcacgacgccattttgaattacaagcgctgg
gaatctgagattcatgcttggcaagaaccgatcctaaacgaccacagccttccagaatgg
taccgctacactctatttaacgagctttactacttggtggctggaggaacgatatggaca
ggtatgaacatgaaacgcatttacacgaccttgctatgtgatttaagtttttcagatagt
tgccgtcaggcgtgtttagctcagaagcttaacccggtaaaatccaatggagtctcggaa
gcattgctagacgctatcaacgcaaattcggaggctcagtcattttggtcctttgatata
ccggcggtcgaagataacgtgggacagtttctctacttggaaggagtggaatatcatttc
tggaacacgtacgacgtgcatttctacgcctcgtatgcactgctggccttgtttccacgg
cttgaacttcaactccagcgagactttgcggctgccaccctttcgcatgacccagaaaag
atgttttatctggcatatggcaacaccggcatcagagctgttttcggttcggttccacac
gacctcggtacgcatgatccgtggaacacacttaacagctacaacttgtacgacactagc
aagtggaaggatctgaattgcaagttcgtggttcaggtaaacagagacgcagctgctaca
ggggatctggatttcgcgagagctgtctggccagcggcatatgcagccatggctttcaca
gaccagtttgatagagatggcgatggtatgattgagaacgacggtgttccggaccagact
tacgacctctggactgtcgacggtgtgagctcgtattgtggaggactgtgggtggcagca
ctccaggcagcttcggcattggctgatctagtcggggacaagccttcgtctagaatgttt
cacgacaagttcctacgagcaaaggctgtctacgagaagtcactgtggaacggctcttac
ttccactacgacaagaacagcacctcggtccagtcggatcaactcgcagggcagtggtat
tctctggcttctggacttcctggaatcgtccgcgaagatcaagctaccagcgcgcttggg
acggttttcgccacaaacgtcatgcggtacaagggaggaaacgaaggcgctgtcaatgga
atgctaccgagtggcggtgaagataggacttcgctccagtctcgggaagtttgggtaggc
accacttatgctgtggcagcggctatgattcagcaaggcatgcgagaagaaggattccgg
actgccaaaggagtgtttttgaatggatggtccgaccagggacacggatatgctttccag
actccagaagcctgggacaacgatggaaagtatcgctcactggcatacatgcgaccgctt
tcgatctgggcgatgcaatgggctctcgatcctccagagcagctcaagcagcgaagttgt
aacgtcgaagttggcgatatcacagcgcaggaagtggaggcttgcaacaaaagctttgcg
aagctggcttcgcagctgaaggagctatcgccgccggagacgaaggcttactcgtcggtg
tggatctggatgttcgactatatccgcagccgcgtctatcccaggggatga

DBGET integrated database retrieval system