KEGG   Selaginella moellendorffii: SELMODRAFT_176264Help
Entry
SELMODRAFT_176264 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
smo  Selaginella moellendorffii
Pathway
smo00860  Porphyrin and chlorophyll metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_176264
Enzymes [BR:smo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SELMODRAFT_176264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 Sigma54_activat MCM VWA_3 CCDC53 RXT2_N Mg_chelatase_C CAP_N PAXIP1_C FAM176 Ribosomal_60s AAA_2 Mito_fiss_reg Pap_E4 CDC45
Motif
Other DBs
NCBI-GeneID: 9639205
NCBI-ProteinID: XP_002977545
JGI: 176264
UniProt: D8S213
Position
Unknown
AA seq 720 aa AA seqDB search
MQRSEVNSRPRSWHVRAAAGGNGAANVVLDKEEAAPSYGRQYFPLAAVVGQEAIKAALLL
GAVDNGIGGIAVAGRRGTAKTVLARGLHALLPPIEIVAGSIANADPSHSEEWEDGLEEKI
ALGSDGKPVVDVVKAPFVQVPLGVTEDRLLGSVDVEESIKQGTTVFQPGLLAQAHRGVLY
VDEINLLDEGISNLLLNVLTEGINVVEREGVSFRHPCKPLLIATYNPEEGAVREHLLDRI
AINLSANAALEFEDRVSAVDIATQFQESSRLVMSNSAEATESARTQIIYAREWLKDVTIG
REQTKYLVMEAIRGGCQGHRAEIGAVRVAKALAALDGRDKVGVDDLKKAVELVIIPRSTL
QDAPEQPNNQSPPPPPPPPPQNQQEDQDKDEEDDEEEDDDESDEQQQEQVPEEFIFDAEG
GLVDSQLLFFAQQAQRRKGKAGRAKNVIFSEDRGRYIKPMLPKGPVRRLAVDATLRAAAP
YQKLRKQRALEQGVSRKVYVEQSDMRAKRMARKAGALVIFVVDASGSMALNRMNNAKGAA
MQLLADSYTSRDQVSIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAV
RVGLNAEKSGDVGRIMIVAITDGRANVSLKKSTGDPEAIAPDAPRPSQQELKDEIKDIAG
KIYKTGMSLLVIDTENKFISTGFAKEIARLAQGKYYYLPNASDAVVSAATKEALTDLKNK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagtgaggtaaattcacggccccggtcctggcatgtacgagcagcagcggga
ggaaatggagccgccaatgtcgttcttgacaaagaagaggcggcgccgagctatgggcga
cagtattttcccctggcagcggtcgtcggccaagaagctatcaaggccgcattgcttctg
ggagctgtggacaatggcattggcggaattgcggttgctggtagacgcgggactgccaag
actgtcttagctcgcggcctacacgcactacttccgcctatagagattgtcgctggctcc
atcgcgaatgccgatccatctcatagcgaggaatgggaagatggtctggaagagaaaatc
gctctaggaagcgatggcaagcccgtggtcgacgttgtcaaagcacctttcgtgcaggtg
ccactcggtgttacagaggatcgtttgctgggctcggtggacgtggaggagtcgatcaag
cagggaaccactgtctttcagccggggctgcttgctcaagctcatcgtggagtactttac
gtggacgagatcaatcttttggacgaaggcattagcaatcttctgctcaacgtgctgact
gaagggatcaacgtggtcgagagggagggtgtgagctttcgccacccttgtaagccgctc
ctcattgcaacttacaacccggaggaaggcgctgttagggagcatctgctagatcgtatt
gctataaatctcagtgctaatgccgcacttgagtttgaggaccgagtttcagcagtcgat
attgcaactcagtttcaagagagttcgagactggttatgtcaaactccgcagaagcaact
gagtccgcaagaacacagataatatatgccagggagtggctcaaagatgtaacaataggt
agagagcaaacgaagtatctcgtcatggaagccattcgtggtggctgtcaggggcatcgt
gcggaaattggtgctgtcagagtcgccaaggcattggcggccttagatggccgagacaaa
gttggcgtcgacgacttgaaaaaagctgtcgaacttgtgatcattcctcgctccacattg
caagacgcaccagagcagccgaacaatcagtcacctccgccaccgcctcctccgcctcca
cagaatcaacaggaagatcaggataaagacgaggaagacgacgaagaagaggacgatgac
gagagtgatgagcaacaacaggagcaagttcctgaagagttcattttcgatgctgaaggg
gggcttgtagactcccagctgcttttctttgcacagcaagcccagcgtcgaaaaggaaag
gccggacgtgcaaagaatgtcatcttctcggaggatagaggccggtatatcaaaccaatg
cttcctaagggtcccgtcaggcggctggccgtggatgcaacgttgagagctgctgctcca
tatcaaaagctacgcaagcaaagagcactcgagcagggtgtctccaggaaagtttacgta
gagcagtcagacatgcgtgcaaaacgaatggcccgcaaggctggtgctttggtgattttc
gtggtggatgcaagtggaagtatggcgctgaatcgtatgaacaatgctaaaggagcggca
atgcaattacttgctgacagctatacgagccgggatcaggtttctatcatccctttccga
ggcgatgccgctgaagtcttacttccaccatcgcgctcgattgccatggcaagaaagagg
ctagagaggttgccttgcggtggtggttctcctttagctcatggtttgagcacggctgtg
agggtgggactaaatgctgaaaagagtggcgacgttggacggataatgatcgttgccatc
actgacggccgggcaaatgtctcgctgaaaaagtctaccggagacccggaagctattgct
ccagacgctcccaggccatcgcagcaggaactcaaggatgagatcaaagacatcgcggga
aaaatttacaaaacagggatgtcactgctggtgatcgacacagagaacaagttcatctcc
actgggtttgctaaggagattgcgcgacttgctcaaggaaagtactactatcttccaaac
gcttccgacgcggtagtatccgccgcaaccaaagaggcactcacggatctcaagaacaag
tga

DBGET integrated database retrieval system