KEGG   Selaginella moellendorffii: SELMODRAFT_180163Help
Entry
SELMODRAFT_180163 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
smo  Selaginella moellendorffii
Pathway
smo00900  Terpenoid backbone biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SELMODRAFT_180163
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SELMODRAFT_180163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 9654897
NCBI-ProteinID: XP_002983411
JGI: 180163
UniProt: D8SJ82
Position
Unknown
AA seq 392 aa AA seqDB search
MASPSLHFADPASNLMGSFASFRGPKCRRKSCLRAMASSSSKNLEIVYDPVGRYEELTRE
LQTSGGFARNLTLFSPSKINVFLRITSKRPDGYHDLASLFHVISLGDTLKFSVSPSKKKD
SLTTNVFGIPLDDSNLVIKALNLYRKKTGSDTYFWVHLDKRVPSGAGLGGGSGNAATALW
AANQINGNLASEADLQEWSAEIGSDIPFFFSHGAAFCTGRGEIVRDIPAPLPLDTPLVLI
KPKEACPTAEVYKHFRIADASSEDPEELLRKIIENGVSQDVCINDLVEAPAFQVLPSLKA
LKQRIMAASRGKYKSLFMSGSGSTLVGVGDPEPPEFIYDDEQHSDTFVSGKSYFVTRRDN
EWYQQPLSQPEAVIDKHDINEVYNQLFTGSDK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccatcgctccatttcgccgatccagcgagcaatttgatgggcagttttgct
tcgtttcgaggacctaaatgcaggagaaaaagctgcttgagagctatggcgtcgtcgagc
tccaaaaacctcgagattgtctatgatccggtcgggaggtatgaagagctcaccagggag
ctgcaaacctcgggtggttttgctcgaaatcttacattgttttcgccatccaagatcaat
gttttcttgagaatcacgagcaagagacctgatggctaccacgatttagcatcactcttt
catgtgattagcctgggagatactttaaagttttcagtttctccttctaaaaagaaagac
tcgcttacaacaaatgtgtttggaatcccactcgacgactcaaacttggtgatcaaagct
ctaaatctttatagaaagaagaccgggagcgacacatacttctgggttcacttggacaaa
agagttccaagcggtgctggccttggaggtggcagtggtaatgccgccactgctctctgg
gccgcaaaccagataaatggaaaccttgctagcgaagcggatctacaagaatggtctgcg
gagatcggctctgatattcctttctttttctcgcatggagcagccttttgcactggccgt
ggagagattgttcgagacattccagctccgttgcctttggacactccactcgtgctcatc
aagcccaaggaagcgtgtcctactgcggaagtctacaagcactttcgaattgccgacgcg
agctctgaggatccggaggagctactgagaaagatcattgagaatggagtctcgcaagac
gtttgcatcaacgaccttgtagaagctccagcatttcaagtgctaccatctctgaaggct
ctcaagcagcggataatggcagccagcaggggcaaatacaagtccttgttcatgtcagga
agtggtagcactctggttggcgtgggagaccccgagccgccagaatttatatacgatgat
gagcaacatagtgatacgtttgtttcaggcaagtcatattttgtgacaaggagagataac
gaatggtaccagcagccactctcgcaacccgaggcagtcatagacaagcatgacatcaat
gaagtttacaatcagctcttcacaggatctgataagtga

DBGET integrated database retrieval system