KEGG   Selaginella moellendorffii: SELMODRAFT_181288Help
Entry
SELMODRAFT_181288 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00562  Inositol phosphate metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_181288
   00562 Inositol phosphate metabolism
    SELMODRAFT_181288
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     SELMODRAFT_181288
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     SELMODRAFT_181288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 9645139
NCBI-ProteinID: XP_002984904
JGI: 181288
UniProt: D8SNE1
Position
Unknown
AA seq 472 aa AA seqDB search
MRALVSVVLLLSTAFADFDVREHLSSSTRYEVSRDLGSKHFTEDPSPPEGCVPIHLNLVA
RHGTRAPTKKRLKQLEELEVRLSELAKSMKAGEFFLPSGWEAAWRGKFVGGELTIPGEEE
MFRLGQRIRERFPEIFSGDYHPKISPILTTQVHRSAQSAVAFGMGLFSNKGSLGDGKHRA
FSVISDNKTNDIHLRFHDCCQNYKESKAVRRPAVAKLQNKVYAQVSAAATKRYKLPFTND
DISSLWFLCKQATSVLEITTQACKLFLPEEVRLLEWADDVELHHLKGYGDSINYKMGISL
LSNVKEAIVSAMEESARDAKFLEKAKLRFAHAETVLPFACLLGLFLDGADVKVVQEEKSV
AIPPKPPLPRLWRGSLVAPFGGNTMLVLYKCSIQSPAFRVQAFHNEHPMIMPACNGSHFC
PVDLFLDKIVSPHLKHSFEVVCFQPKKVSWFSSLLRLFGLRRKPSPDDDHEL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcgtgtcggttgtgctgctgctgtccactgcatttgcagatttcgacgtg
cgcgagcacctttccagctccaccaggtatgaagtttcgcgagatcttggaagcaagcac
ttcacggaggatccatcgccgccggaaggctgcgttcctattcacttgaatcttgtggca
aggcatgggacgcgagcgcctacaaagaagcgcttgaaacagcttgaggagctggaagtc
aggctcagtgagcttgccaagagcatgaaggctggagagttttttctgccttccggatgg
gaggccgcatggagaggaaagtttgtcggtggcgagctgacgatccccggtgaggaggag
atgttccggcttgggcagaggatccgggagaggttcccggagatttttagtggtgactat
catccgaaaatcagcccgatcctcacgactcaggttcacaggtctgcgcagagtgccgtt
gccttcggcatgggtttgttctcgaacaaaggatcgcttggcgatgggaagcaccgcgca
ttttcagtgatcagcgacaacaaaaccaatgacatacacttaagatttcatgactgttgt
caaaactacaaggaatccaaagctgttcgaagaccggctgtggccaaactccaaaacaaa
gtatatgcacaggtctccgcagccgctacgaagaggtataaattaccgtttacaaacgat
gatatttcttctttatggtttttatgcaagcaggcaacatctgtgttagagatcactacg
caagcttgcaagctctttcttccagaagaggttcgtctacttgaatgggcggacgacgtt
gagctacatcatctaaaaggctatggcgattcaatcaactacaaaatgggcatctctcta
ctttccaacgtgaaagaagctattgtttcggctatggaggaaagcgccagagacgctaag
tttctggagaaagccaagttgcgatttgcacacgcggaaacagtactgccgttcgcgtgc
ctccttggcctctttttagacggagctgatgtgaaagttgtacaggaggagaagtccgtc
gcgattcctcccaaacctccactccctcgactctggaggggaagtctagtagcacctttt
ggaggtaacacgatgctggtactttacaagtgctccatccaaagtccagccttccgggtg
caagcctttcacaatgaacatccaatgattatgccagcatgtaatggatcgcatttttgt
cccgtggaccttttcctggacaagattgtttccccgcacttgaaacacagcttcgaggtg
gtgtgtttccagccaaagaaagtctcctggttttccagcctgcttcggctctttggactg
cggaggaagccatcgccagacgacgatcatgagctgtga

DBGET integrated database retrieval system