KEGG   Selaginella moellendorffii: SELMODRAFT_181373Help
Entry
SELMODRAFT_181373 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SELMODRAFT_181373
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SELMODRAFT_181373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 9648971
NCBI-ProteinID: XP_002984958
JGI: 181373
UniProt: D8SNQ3
Position
Unknown
AA seq 680 aa AA seqDB search
MASTNISPLTLLLSALLLVAGALFLWWKAADAGKRVAEPPTVVTPIVEAEEEEADDLAGY
TSKVTVFFGTQTGTAEGFAKALVEEAKSRYDRVLFKAVDLDNYAADDDHYRLRLKKEKLA
IFMLATYGDGEPTDNAARFYKFLTEGGDERGLWLNEMTYAVFGLGNRQYEYFNKVGKDVD
EELEKQGAKRLVPCGVGDDDQCIEDDFSAWREQLWPELDALLRNEDDVAIPSTTTYTAAV
SEYRVVIHEKLAKLVEGSFLPVENGGPVVIDMNHPCRAIVAARKELHTPLSDRSCTHLEF
DIAATGISYETGDHVGVYAENCHDVVEEAANLLDYTLDTVFSLHTDTEDGTPLPGSLLPP
FPTPCTLRTALARYADLQTPPRKAVLAVLAAYTSETSHADRLKHLASLQGKEDYSQYISS
CQRTLLEVLADFSSVKLPLGVFFASVAPRLMPRYYSISSSPKFAPTRIHVTCALVHGPSP
TGRLFRGVCSTWMKNARSAEEAGDDCSWAPIFVRQSNFKLPADPKIPIVMIGPGTGLAPF
RGFLQERAALQDSGEQLGPSVLFFGCRNRNQDFIYERELNEYVSRGTLANLYVAFSREGS
TKEYVQHKMQDKATDLWRLLSNGAYLYVCGDAKGMARDVHKMLLTIVQTESTFSWQGNVK
EAEAFVKQLQNDGRYLRDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccaacatctccccgctcaccctgctgctgtcggcgctgctcctcgtggcc
ggggcgctcttcctctggtggaaggcagctgatgccggcaagcgcgtggcggagccgccc
acagtggtgacgccaattgtggaagccgaggaggaggaggccgatgatctagcaggctac
acgagcaaagtgaccgtcttctttggcacccaaaccggaaccgcggaaggttttgcaaag
gccctggtcgaggaagcaaagtctcgatacgacagggttctcttcaaggccgtcgacttg
gacaactacgcagcggacgacgaccactatcggctcaggctcaagaaggagaagctggcc
atctttatgctcgcaacgtatggtgacggagaaccgacggacaatgcggccaggttctac
aaattccttacggagggtggtgacgaaagaggcttgtggctgaacgagatgacttacgcg
gtgtttggtctgggcaaccgccagtacgagtacttcaacaaggttggaaaggacgtggac
gaggaattggagaagcaaggtgccaaaaggcttgttccctgtggagttggcgatgacgac
caatgcatcgaagacgatttctccgcctggcgcgagcagctatggccggagcttgacgct
ttgcttcggaacgaggacgacgttgccattccttccactaccacttacacggcagctgtc
agcgaataccgagttgtaattcatgagaagctagcaaaactcgtcgaagggagctttctc
ccggtggaaaacggtgggcctgtcgttattgatatgaaccatccttgtcgagccatcgtg
gccgctcggaaagagctccatacgcccttgtccgacagatcgtgcacccacttggagttc
gacatagctgcgactggcatcagttacgagactggagaccatgttggtgtgtacgctgag
aattgtcacgacgttgtggaggaggctgccaatcttctagattatacgctggacacagtc
ttttcacttcacacagacacggaagatggcactccgttgcctggtagccttcttccgcca
tttcccacaccctgcactctaagaactgccttggctcgttatgccgacttgcaaactcct
cctcgcaaggctgtgcttgctgtccttgcggcatatacatcagagactagccatgcagac
cgtttgaagcacctagcatcgctgcaaggaaaggaggactattcgcaatacatttcttcg
tgtcaaaggaccctgctggaggttttggctgacttttcctctgtcaagctgccactcggg
gtcttcttcgcttcagtggctccgcgtttgatgccaagatattattccatctcgtcctct
ccaaagtttgcgcccactaggattcacgtcacttgcgcgttagttcatggaccaagtcca
actggccgcctgtttagaggagtttgctctacatggatgaagaatgctcgctccgccgaa
gaggccggcgatgactgcagctgggctcctatatttgtgcgacaatcaaacttcaagctt
cctgcggacccgaaaattcccatcgtgatgataggacctggcaccggcctggcacctttc
agaggattcctccaggaaagagctgctctacaagattcgggtgaacaactggggccctcg
gttcttttctttggatgccgcaatcggaatcaggatttcatttacgagcgcgaactgaac
gagtatgtgagcagaggaactttggcaaacctgtacgtggccttttcgcgagagggctcc
accaaggaatacgtccaacacaagatgcaagacaaggctactgacttgtggagacttctg
tctaacggggcctacttgtatgtctgcggcgatgccaaaggaatggctcgcgacgttcac
aagatgctgcttaccattgtccaaaccgagtcaactttttcttggcagggcaacgtcaag
gaagctgaggcttttgtcaagcaactgcaaaacgatggtcgatatttgagagacgtctgg
tga

DBGET integrated database retrieval system