KEGG   Selaginella moellendorffii: SELMODRAFT_183809Help
Entry
SELMODRAFT_183809 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smo  Selaginella moellendorffii
Pathway
smo00052  Galactose metabolism
smo00500  Starch and sucrose metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SELMODRAFT_183809
   00500 Starch and sucrose metabolism
    SELMODRAFT_183809
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SELMODRAFT_183809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_130
Motif
Other DBs
NCBI-GeneID: 9636305
NCBI-ProteinID: XP_002988349
JGI: 183809
UniProt: D8SYC4
Position
Unknown
AA seq 532 aa AA seqDB search
MNDPNGPLFYKGVYHLFYQWNPYAAVWGNITWGHAVSTDLIHWKYVKELALVPDRWYDIK
GVWSGSATIVNGEPILLYTGWTNSSTQVQNKAVPKNSSDPLLREWIKVDAENPFAVPPPG
INTSDFRDPTTAWIGQDGLWRTAVGSKYRANDTGIILQYRSKDFAKWELLDESLHAVNGT
GMWECPDFFPVAVHGQQGSENYLGEENAIQKFVIKVSLDETRFDTYVVGDYDPASEKFLP
SFEALDIGTALRYDYGIYYASKSFYDPHKKRRVLLGWINEADKPTSDIRKGWASVQAIPR
VVWLDENQHSLRQWPVPEINSLRKHPIRHTDLLLKQGEVFKVNGSQGSQLDIEVTFQIPK
AHANDENDEFNFESSRVEGIPNNTLIYCNGSFPEAEQIIGPFGVHVLASEDLRERTSVFF
KFLKFKGSWKTMVCNDLTSSSLASDATKGVYGGLVSLSSYKNRQALTMRILVDHSIVETF
AQGGRTCITARSYPLLGSDNNAHMFVFNNGSLPVKATHLAVWKMDKIRYTTV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccaaatggtcccctgttttacaaaggcgtgtatcatctcttctatcaatgg
aacccctacgctgccgtgtgggggaacatcacttggggccacgccgtctccacggatcta
atccactggaagtacgtgaaggagctagctctcgtgccagatcgatggtatgacatcaag
ggcgtgtggtcgggatccgcgacgatcgtcaatggcgagcccattcttctctacactgga
tggacgaattcctccacgcaagtccaaaacaaggctgtgcccaagaactcctccgatccg
ctactgcgcgaatggatcaaagtcgacgcggagaatcctttcgcggtgccgccgccgggg
atcaataccagcgatttccgggacccgacgacggcgtggattgggcaagatgggctatgg
cgcactgcagtgggatccaagtatcgcgccaacgacacagggatcatcctgcagtaccgc
agcaaggatttcgcgaaatgggagctcctggatgaatcgctccacgcggtgaatgggacg
gggatgtgggagtgcccggatttcttcccggttgcggtccatggccagcagggctcggag
aactatcttggcgaggagaatgcgatccagaagttcgtgatcaaggtcagcctggatgag
acgcgatttgacacgtatgtggtgggcgattacgacccggcgtcggagaagttcttgccc
agcttcgaggcgctcgatattggaacggcgctgcgctatgactatgggatttactacgcg
tccaagtcgttctatgatcctcacaagaagaggagagttttgctgggatggatcaacgag
gccgacaagcccacgtcggacattcgcaagggatgggcttctgtccaggcaattcccaga
gttgtatggctcgacgaaaaccagcattcccttcggcagtggcccgtgccagagatcaat
tctctaagaaagcatccaattcgtcatacagatttgctcttgaagcagggagaagttttc
aaagtaaatggctctcaaggatcgcagctcgatatcgaggtgacttttcaaatcccaaag
gctcacgccaacgatgagaacgatgaatttaactttgaatcgtccagagtcgagggaatt
ccaaacaacaccctcatatactgcaatggcagctttccagaggccgagcagataatcggc
ccgttcggagtccacgtccttgcgtcggaggatctacgcgagagaacttccgtgttcttt
aagttcctcaagttcaaaggttcctggaaaactatggtttgcaacgatctcacaagctct
tccctggcatccgatgctacaaaaggcgtctacggtggactagtaagcctctcgagctac
aagaatcgtcaggctttgacaatgagaatcttggtggatcattccatcgtcgaaacgttt
gctcaaggcggccggacatgcatcactgctcgatcctatcctcttctcgggagtgacaac
aacgctcatatgttcgtgttcaacaatggaagtcttccagtcaaggcaacacacttggct
gtgtggaagatggataagattcgctacaccacagtctag

DBGET integrated database retrieval system