KEGG   Selaginella moellendorffii: SELMODRAFT_185796Help
Entry
SELMODRAFT_185796 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_185796
Enzymes [BR:smo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     SELMODRAFT_185796
Membrane trafficking [BR:smo04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    SELMODRAFT_185796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 9633764
NCBI-ProteinID: XP_002991031
JGI: 185796
UniProt: D8T637
Position
Unknown
AA seq 272 aa AA seqDB search
MGLSRCLTLPILAFLVLLLSNYYIVVVLALQPWIGVPALLHALLFTLLNVMILISHGLAV
LRDPGQVPANYSPDLETDQSTVLKGKERRFCEKCGLYKPARAHHCRICKRCILRMDHHCS
WLNNCVGHRNYKAFLLLVFYLFLGCSYSLAIFGGSTLNNSSTYQFWKVMYGVCLVVGVLI
FGSMQAWYAYLLVQNKTTIEFHQGKREGWIAVKAGQIYRHPYDLGLLANLINVLGPKTKY
WLCPMSVGHIGSGLWSRTLSETHINNILADSS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctcgagatgcttgacgctcccgatcctggcattcctcgtcctgctgctctcg
aattattacatcgtcgtggtcttggcgctccagccttggatcggcgtgccagctttgcta
catgcgctgctcttcacgctgctcaacgtgatgatcctcatctctcacgggctggctgtt
cttcgtgatcccggacaggtgccagcgaattactctcccgatctagagaccgatcagagc
actgtcttgaagggaaaggagagaaggttttgcgagaaatgtggcctctacaaaccggct
cgagctcatcactgccggatttgcaagcgttgcattctgcgaatggatcatcactgttct
tggctgaataactgcgttggccaccgaaactacaaagcgtttctcctcctcgtcttctac
ctcttcttggggtgctcatactctctggccatctttggaggatcaactctaaacaattcg
tcaacgtatcagttctggaaggtcatgtacggcgtttgcctggtggtgggagttttgatc
tttggatcaatgcaagcttggtatgcatatctcctcgtccaaaacaagactacgatcgag
tttcatcaagggaagagggaaggctggatcgcagtgaaggctggtcaaatctacaggcat
ccgtatgatctggggcttcttgcgaatctaatcaatgttttgggaccaaagacaaagtat
tggctgtgtccaatgtctgttgggcacatcggctctggcttgtggtcgagaactctctcc
gagacccatatcaacaacattctagctgattctagctga

DBGET integrated database retrieval system