KEGG   Selaginella moellendorffii: SELMODRAFT_231526Help
Entry
SELMODRAFT_231526 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
smo  Selaginella moellendorffii
Pathway
smo00010  Glycolysis / Gluconeogenesis
smo00053  Ascorbate and aldarate metabolism
smo00071  Fatty acid degradation
smo00280  Valine, leucine and isoleucine degradation
smo00310  Lysine degradation
smo00330  Arginine and proline metabolism
smo00340  Histidine metabolism
smo00380  Tryptophan metabolism
smo00410  beta-Alanine metabolism
smo00561  Glycerolipid metabolism
smo00620  Pyruvate metabolism
smo00903  Limonene and pinene degradation
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SELMODRAFT_231526
   00053 Ascorbate and aldarate metabolism
    SELMODRAFT_231526
   00620 Pyruvate metabolism
    SELMODRAFT_231526
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SELMODRAFT_231526
   00561 Glycerolipid metabolism
    SELMODRAFT_231526
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SELMODRAFT_231526
   00310 Lysine degradation
    SELMODRAFT_231526
   00330 Arginine and proline metabolism
    SELMODRAFT_231526
   00340 Histidine metabolism
    SELMODRAFT_231526
   00380 Tryptophan metabolism
    SELMODRAFT_231526
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SELMODRAFT_231526
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SELMODRAFT_231526
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SELMODRAFT_231526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 9631989
NCBI-ProteinID: XP_002970420
JGI: 231526
UniProt: D8RHL6
Position
Unknown
AA seq 488 aa AA seqDB search
MKSSILNSLSMGSLWTLPLVSETFPTVDPRTEEVLADVAKADVEDINRAVKAARKAFDHG
PWPRMTAYERSKILLKYADLLEKHNDELATLDSLDSGKLYSQSQGVEIPHFVTRLFRYYA
GWADKIHGKTLPADGPHQVLTFHEPIGVVGQIIPWNFPMVMFAWKVAPALACGNTIVLKT
AEQTPLSACLAAKLAVEAGLPPGVLNVVSGFGETAGAAISSHMDIDKVAFTGSTETGKLV
MQAAARSNLKPVTLELGGKSPFIIMPDADIDQAVELSHFALFFNQGQCCCAGSRTFVHES
IYDEYIEKAKARALKRVVGDPFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGAR
IGNKGYYIQPTIFSDVKDDMAISRDEIFGPVQAVTKFRTVQEAIERANNSPYGLAAGVFT
KDIDTANTFSRALRVGSVWINCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVT
PLKNPAWL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccagcattctaaactctttatcgatggggagtttgtggacgctgcctctggta
agcgagacattcccgactgtggatcctcgaaccgaggaagtccttgccgatgttgccaag
gcggacgtggaagatatcaatcgggctgtgaaagctgctcgcaaggcttttgatcacggt
ccctggccaagaatgacggcttatgaaagatcgaagatcttgctgaagtatgccgacctc
cttgagaagcacaacgatgagcttgcaacgctggattctttggacagtggaaagctttac
tcgcagtcgcaaggagttgagattcctcactttgtgacgaggctctttcgctactatgca
ggatgggcggataaaatccatggtaaaacactgccggctgacggaccacatcaggtgctt
acatttcacgagccaatcggtgtagtcggccagatcattccgtggaactttcccatggtg
atgtttgcctggaaagtggctcctgctctcgcctgtggcaataccatcgtcctcaagacc
gccgaacagacaccgctctcggcctgtctcgcagcaaaacttgcagtcgaggctggctta
ccaccgggagttcttaacgtcgtttcgggctttggggaaactgcaggtgccgcaatctcg
agccacatggacatagacaaggttgctttcactggttctactgagaccggcaagctcgta
atgcaagcagccgctagaagcaacttgaagccagttactttggaattgggcggaaagtct
cctttcatcatcatgccggatgcggatattgaccaagctgtggagctctctcactttgct
ttgttcttcaaccagggacaatgctgctgtgcgggatcaagaacgttcgttcacgagagc
atttatgacgagtacattgagaaggcgaaagctcgtgcattgaagcgcgttgttggcgat
ccattcaagagcggggtggagcaagggcctcaggttgacaaagctcagtttgagaagatc
ctgagctacattgacgtaggaagacatgagggagcaaatctggtcactggcggcgctcgt
atcggaaacaaaggatactacatccagccaacaatcttcagtgatgtgaaggacgacatg
gcgatatcgagagacgagatctttggccccgtccaggccgtgacaaagttcaggaccgtg
caagaagccatcgagagagcgaacaactcgccgtatggcttggccgcgggagtgttcaca
aaggacatcgacacggccaacacgttcagccgtgcactgcgagtgggatctgtgtggatc
aattgctacgacgtgtttgatgcggcgattccctttggcggctataagatgagcgggcaa
ggacgagagaagggcgagtacgtgctgcacaactacacgcaagtcaaggcagtggtaacg
ccgctcaagaatcccgcatggctctga

DBGET integrated database retrieval system