KEGG   Selaginella moellendorffii: SELMODRAFT_267120Help
Entry
SELMODRAFT_267120 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
smo  Selaginella moellendorffii
Pathway
smo00460  Cyanoamino acid metabolism
smo00500  Starch and sucrose metabolism
smo00940  Phenylpropanoid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELMODRAFT_267120
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SELMODRAFT_267120
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    SELMODRAFT_267120
Enzymes [BR:smo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SELMODRAFT_267120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 9635766
NCBI-ProteinID: XP_002967460
JGI: 267120
UniProt: D8R8G0
Position
Unknown
AA seq 510 aa AA seqDB search
MPGFGAMGMVLVFVVLVALSRSKAVFGSQGEALSRCSFPRGFVFGTSSAAYQYEGAVREG
GRGPSIWDIFSHNSTNISDSSNGDVTEDQYHRYKKDVLLMKEMFMDAYRFSISWSRIYPD
GQSSPANGEGIAYYNSLINSLLEQGIQPYVTLYHWDLPQALEDSLGGWLNPQIVKEFTKY
AETCFDAFGDRVKHWITFNEPHSFVREGYCLGVSAPGRCSGCIGGNSATEPYIAAHNVLL
SHASAAQVYKKKFQAQQKGKIGIALNADWYEPFSNSSADKAAAIRATDFQLGWFLNPIVY
GNYPPVMRSYVASRLPQFTGNEAGLLMSSLDFLGLNHYTSNYAQDSPEVPPSMTNYDLDS
RVRSLVSRDGVPIGPKGSSTWLYVVPWGFRKLLGYIKAHYKNPIIVITENGMDQASGHNL
SQSLGDKTRIDYHQEYLANLNLAITRDSVDVRGYFAWSLLDTWEWSHGFTVRFGLYFVDY
TNGLKRYPKMSARWFRRLLCWNVTCSVNIV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcctggttttggtgcgatgggcatggttctagttttcgttgtccttgtggcgctatct
cgcagcaaagcagtatttggttctcaaggcgaagcacttagcagatgcagcttccctcga
ggctttgtatttgggacttcgtcagctgcgtaccagtatgaaggagcagtgcgagaaggc
ggacgaggaccgagcatttgggacattttctctcataattcaacaaatatttcagacagc
agcaatggggatgttacagaagatcaatatcatcgctacaagaaggatgtactgttgatg
aaggaaatgtttatggatgcttatcgcttctccatttcatggtcgcgcatttatcctgat
ggacaaagcagcccagcgaatggcgagggtattgcatactacaactcgcttattaacagc
cttttagagcaaggaatccaaccatatgtgacactgtaccattgggacctgcctcaggca
ttagaagactcgttaggcggctggcttaatcctcagattgtaaaagagttcacaaagtac
gcagagacatgcttcgatgccttcggagaccgcgtaaaacattggataacgttcaacgag
ccgcattcgtttgtgagggaaggttactgtctgggagtatcagcacctggacggtgctct
ggatgcatcggtggaaattcagctactgagccttacatagcagcgcacaatgtactgctg
tctcatgcttcggctgctcaagtgtacaaaaagaagttccaggctcagcagaaaggaaaa
attggcatcgcgctaaatgctgactggtatgaaccattctcaaactcctcggcggacaaa
gcagctgcgataagagctactgacttccaactaggatggtttctaaatcctattgtctac
gggaactatccgcctgtgatgagaagctatgtagccagtcgcctgccacagttcacaggg
aacgaagccggcttattgatgagttcgctggattttctcggtttaaaccactacacctca
aactatgcgcaggattcgccagaagttccaccaagcatgacgaactacgaccttgattcc
agagttcgttcgttggtcagtcgagacggggtgccaatcggtcccaagggttcctcgacg
tggctctatgttgttccatggggtttcagaaagctcctggggtatatcaaggctcattac
aaaaatccaatcattgtcatcacagagaatggaatggatcaagcaagcgggcacaacctt
tcgcagtcccttggagacaagaccagaattgattaccaccaggaataccttgcaaacttg
aatctggccattacgagagacagtgttgacgtccgcggctactttgcatggtctttgttg
gatacatgggaatggtctcatggttttacagtccgatttgggttatactttgtggattat
accaatggactcaagcggtaccccaagatgtccgcccgctggttcagacgactgctctgc
tggaatgtaacttgctctgtaaatattgtctga

DBGET integrated database retrieval system