KEGG   Selaginella moellendorffii: SELMODRAFT_267315Help
Entry
SELMODRAFT_267315 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
smo  Selaginella moellendorffii
Pathway
smo00020  Citrate cycle (TCA cycle)
smo00480  Glutathione metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
smo01210  2-Oxocarboxylic acid metabolism
smo01230  Biosynthesis of amino acids
smo04146  Peroxisome
Module
smo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SELMODRAFT_267315
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_267315
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SELMODRAFT_267315
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SELMODRAFT_267315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9645366
NCBI-ProteinID: XP_002969739
JGI: 267315
UniProt: D8RFG1
Position
Unknown
AA seq 418 aa AA seqDB search
MAFEKIKVENPIVEMDGDEMTRIIWQMIKDKLIFPFLDLDIKYFDLGLPHRDETDDKVTV
ESAEATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIVCKNVP
RLVPGWTKPICIGRHAFGDQYRATDTVIKGSGKLKLVFVPENGEASEFEVYDFKGDGGVA
LSMYNTDESIRSFAQASMTTALAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAEWKSKF
EEAGIWYEHRLIDDMVAYALKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPD
GKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLSHRASLDGNARLSDYAEKL
EAACVGIVESGKMTKDLALLIHGPKVTKKDYLNTEEFIDAVAADLKLRLTTVPSKLEA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgagaagatcaaggtggagaatcccatcgtggagatggacggagatgagatg
acccggatcatctggcaaatgatcaaggacaagctcatttttccattccttgatttggat
attaaatactttgacttgggccttccacatcgtgacgaaactgatgacaaagtcacagtt
gagagtgccgaagcgaccctcaagtacaatgttgcgatcaagtgtgcaacgatcacgcca
gacgaagctcgagtcaaggaattcggcctcaaggcaatgtggaaaagtcccaatgggaca
attcgtaacattttgaacgggactgtttttagagagccgattgtctgcaagaacgtcccg
aggcttgttccagggtggacgaaaccaatttgcattggaaggcatgcttttggagaccag
tatcgtgccactgatacagttatcaagggctctggaaagcttaagctggtttttgtgcct
gagaatggagaggcctctgaattcgaggtttacgacttcaagggagatggaggagtcgct
ctttctatgtacaacactgatgagtccattcgttcctttgcacaagcctctatgactacc
gctctggcaaagaagtggcctctatacttgagcaccaaaaacacgattttgaagaagtac
gatggcaggtttaaggatatcttccaagaggtctacgaggcggagtggaagagcaagttt
gaggaagctggcatctggtacgagcatcgcctgattgacgatatggttgcttatgctctc
aagagcgatggtggatatgtctgggcatgcaaaaactacgatggtgatgtgcagagcgac
tttttggctcaaggatttggttcccttggattgatgacttctgtgctggtctgtcccgat
ggaaagaccattgaagccgaagctgctcacgggactgtaactcggcactatagagtacac
cagaaaggcggtgaaaccagcaccaatagcattgcctccatctttgcctggtctcgaggc
ctttctcacagggcctcactggatggcaatgcacggctaagcgactacgcggagaagctc
gaggcggcttgcgtaggaatcgttgagtctggcaaaatgacaaaggatctcgctctgctc
atccacgggccaaaggtgacaaagaaagattatcttaacaccgaggagtttatcgatgcc
gtggctgccgatcttaagctcaggctgacaaccgtgccttccaaattggaagcctga

DBGET integrated database retrieval system