KEGG   Selaginella moellendorffii: SELMODRAFT_268258Help
Entry
SELMODRAFT_268258 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
smo  Selaginella moellendorffii
Pathway
smo04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:smo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    SELMODRAFT_268258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smo04131]
    SELMODRAFT_268258
   03029 Mitochondrial biogenesis [BR:smo03029]
    SELMODRAFT_268258
Membrane trafficking [BR:smo04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    SELMODRAFT_268258
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    SELMODRAFT_268258
Mitochondrial biogenesis [BR:smo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    SELMODRAFT_268258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Peptidase_U57 Atg14 Spc7 HMMR_N Fez1 Fib_alpha SKA2 zf-C4H2 TSC22
Motif
Other DBs
NCBI-GeneID: 9634124
NCBI-ProteinID: XP_002979247
JGI: 268258
UniProt: D8S7R6
Position
Unknown
AA seq 511 aa AA seqDB search
MPVPEERAAAAIAQACVALRRRKAVEEGAHASLVAALDRALTNQGTEIQEKMESLQQELS
QSYKTQAHVSEQLVVEMQTAQALRAQLAEKDALVLEIQHELSSARARISQLEKDFEAKEN
AVLVLVEELTQLKLRVKELESSLQAIEAENNMLVDRWMTQKMQDADRLNEANAMYADMME
RCKINSLAELAKLQVDGIVRHSEAGAESYMTLGAPSKVRHTLRAHDKGGCAAIIFEHSSD
TLLTAGHDGIVKFWDTQRGGTPTKTLTGALGSVLDLALTPENNMVLGGCSDHKLYLWDSR
SGRVKHVLTGHTEKVTSVDISNVRAASTASDRTIKTWDLQTGYSLHTMIFHSNCNSLCIS
SDGAAICSGHTDGILRFWDTRTGKLAKELTAHEPQAITSVSLSRSGLTVLTSGKDNVLKL
FDVRSLELKATFRGPGYTVATSLSRSCLSRDENYVAAGSGDGSVCIWNRRSWEVESVLKG
GHGSAVVACAWSPASKSLASADRNGVVCVWE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcccgaggagagagctgccgccgccattgctcaagcatgcgttgccctgcgg
cgacgcaaggccgtcgaggaaggagctcatgcatcgctggtcgcggcgcttgatcgggcg
ctcacgaatcagggcacggagatccaggagaagatggaatctcttcagcaggagctgtcc
cagagctacaaaacccaggctcatgtgtcggagcagctcgtcgtagagatgcaaacggcg
caagctctacgagcgcaactggccgagaaggacgcgcttgttttggagatccaacacgag
ctaagctccgcgagggcgcgtataagccaattggagaaggactttgaagcaaaggagaac
gctgttcttgtgctcgtcgaggagctcacacagctaaagctccgagtgaaagagctcgaa
tcgagcctccaagccatagaggctgagaacaatatgcttgttgatcgctggatgacgcag
aaaatgcaagacgctgatcgacttaatgaggctaacgccatgtatgctgacatgatggaa
cgctgcaagatcaacagccttgccgagctagcgaagctccaagtcgacggcattgtaagg
cactcggaagctggcgccgagagctacatgacgctgggcgcgccgagcaaagtccgccac
acacttcgtgctcacgacaagggaggctgcgccgccatcatcttcgagcacagcagcgac
accctcctcaccgccgggcacgacggcatcgtaaagttctgggacactcagcgcggagga
actcccacgaaaactctcaccggcgctctcggctcagtactggacttggcactcaccccg
gagaacaacatggttctcggcggctgcagcgatcacaagctctacctctgggactcccgc
tccggccgagtgaagcacgtcctcacaggccacaccgagaaagtcacctccgtggacatc
agcaacgtgagagccgcgagcacggcctcggacaggaccatcaagacttgggacctccaa
acgggctacagcctccacacgatgatcttccacagcaactgcaactctctctgcatctcc
tccgacggcgcagcgatttgctccggccacacggacgggatcttgcgcttctgggacacc
cgaacagggaagctggccaaggagctcacggctcacgagccacaggccataacttcggtg
tcgctgtcccggagtggcttgacggtgctcaccagcggcaaggacaacgtcctcaagctc
ttcgacgtgaggagcttggagctcaaggcgactttcagggggccgggctacacggtggcg
acgagcttgagccgatcgtgcttgagccgggacgagaactatgtggcggcgggctccggc
gatggaagcgtttgtatctggaatcgccgctcctgggaggtggagagcgtgctcaaaggc
gggcatgggagcgcggtggtggcgtgtgcttggagcccagccagtaagtcactggcctcg
gccgatagaaatggtgtggtgtgtgtgtgggagtga

DBGET integrated database retrieval system