KEGG   Selaginella moellendorffii: SELMODRAFT_418835Help
Entry
SELMODRAFT_418835 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
smo  Selaginella moellendorffii
Pathway
smo00270  Cysteine and methionine metabolism
smo00480  Glutathione metabolism
smo01100  Metabolic pathways
Module
smo_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SELMODRAFT_418835
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_418835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smo04147]
    SELMODRAFT_418835
Enzymes [BR:smo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     SELMODRAFT_418835
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELMODRAFT_418835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synthase GSH_synth_ATP
Motif
Other DBs
NCBI-GeneID: 9660151
NCBI-ProteinID: XP_002979116
JGI: 418835
UniProt: D8S6I9
Position
Unknown
AA seq 181 aa AA seqDB search
MLNSFNDVPVAFGDVLGLAWKEFGNTSDGHLVAVAYYRSGYEPTDDPSELEWHARLLLER
YKMSMDLIPLGWNQKSATRAWQAKCIRKVLPSFVFSTPRNNKYGSAVKAKLLGDGGAGLS
VYIVMQRIFPPTYTSYLVRGGERQSWSWESLAHTLSLFFSSLNFLQGMTKDKSPTRIVAT
C
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctcaactcttttaacgacgtccctgttgcatttggtgatgtcttgggacttgcttgg
aaagaatttgggaacacgagtgatgggcatcttgtcgcagttgcctactacagatcaggc
tacgaacccacggatgatccttccgagctggaatggcacgcgagattgctgctggagcgt
tataaaatgtccatggatctcataccacttggctggaaccaaaaaagtgcaacaagagct
tggcaagccaaatgtattagaaaggtactgccatcctttgttttcagcactccaaggaac
aacaaatatggcagcgccgtgaaagcgaagctactgggagacggaggagccgggctttcg
gtttatatcgtcatgcagcgcatcttcccaccgacctacacgtcttatctcgtgcgagga
ggcgagcggcagtcttggagctgggaatctttagcacataccttgtctctttttttctcc
tctctcaatttcttgcaaggaatgacgaaagacaaatcgccaacaaggattgtggctact
tgctga

DBGET integrated database retrieval system