KEGG   Selaginella moellendorffii: SELMODRAFT_427302Help
Entry
SELMODRAFT_427302 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smo  Selaginella moellendorffii
Pathway
smo00500  Starch and sucrose metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SELMODRAFT_427302
Enzymes [BR:smo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SELMODRAFT_427302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77 CBM_20
Motif
Other DBs
NCBI-GeneID: 9638347
NCBI-ProteinID: XP_002988641
JGI: 427302
UniProt: D8SZ64
Position
Unknown
AA seq 883 aa AA seqDB search
MDAPGMDSSRAIDRERAMIGARAAEPRRVNLRFRIPYFTQWGQNLIVTGSHSSLGSWNLH
HGLAMVPHHDEELGELVWTAQLPVREGFQASYSYCVVDDKRNAVRREAGNPRSFVLPDGI
PSGSIVDLYDLWQEGCSPESLLSRSAFRDAIFRNSKSSSTCEETGTPFTGSYGAELLKDR
GKIGVCFELSCSILENGQVVYVTGSSSSLGSWDYESALKLTRTGDSSWHGCCAIDKQDFP
GDLWRGAGLAIPVFSIRTHADVGAGEFLDLKLLVDLAVKSGLRLLQLLPVNDTSVHGMWW
DSYPYSSLSVFALHPLYLSLEAMTERLPQELQDEISQARKKLDLKDVDYEGTMKTKLSIA
KKIFHIEKEAAFNSSKFKTYFDENKHWLEPFAAFCFLRDLFDTADHSQWGRFSTFSPEKL
EKLVSPSSDHYNLISFTYFLQYHLHSQLTEASEYARNNGVVLKGDLPIGVDRNSVDTWVF
PTLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNFAWWRARLTQMSKYFTAYRIDH
ILGFFRIWELPAHAVTGLMGKFRPSLPLTQEELEAQGIWDFNRLSEPYVRCHTLQAKFGD
AWSEIASKYFDEYEHLCYKFKKEHDTERKILGAVSQLEDSKKQEQIKGALFDLLRDVVLM
RDPEDSRKFYPRFGMENTSNFKELDEHSKNVLQRLYYDYFYHRQEGLWRENALKTLPVLM
SSSEMLTCGEDLGMVPACVAPVLNELGLLGLRIQRMPSTPGQEFGNPLEYEYMTVCAPSC
HDCSTMRAWWEDDEGRRIRFYKDYLGMSESPPAQCLPDVARVIIEQHMKSPSMWAIFPLQ
DLLALKEEYTGRPANEETINDPTNPKHYWRFSKSMLVLFCRDF
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgccagggatggattcctcgcgcgcgatcgatcgagagagggcgatgatcggc
gccagggcagcggagccgcggcgcgtcaatctgcgcttccggattccatatttcacgcaa
tggggccagaatctcatcgtcacaggttcgcattcctctctcggcagctggaatctccac
catggactggcgatggttccacaccacgacgaggagctcggcgagctggtctggaccgcg
cagctgcccgtgcgcgagggattccaggcgagctactcgtattgcgttgtggatgataag
cgcaatgcggtcaggagggaggctggaaatccccggagctttgttcttccggatggaatt
cccagtggcagcattgttgatctatatgatctctggcaggaaggctgttctccagagagt
ttgctgtcacgcagtgctttccgtgacgcgatttttagaaactccaagtctagtagcact
tgtgaggagactggtactccctttaccggcagctatggcgccgagctcctcaaagatcgt
ggaaaaattggtgtctgctttgagctcagttgttccatcttagagaatgggcaagttgtt
tacgttactggaagttcgagttctcttggaagctgggactatgaatcagcacttaagctt
acgagaacgggcgattcaagctggcatggctgctgtgcaatcgataaacaagactttccc
ggtgatctgtggagaggtgctggccttgccatccctgtgttttcaataaggacgcatgcg
gacgttggagcgggcgagtttttggacctgaaactgcttgtggatttagcagtgaagtct
ggattgaggcttctacagttgctaccagttaatgatacttccgtgcacgggatgtggtgg
gactcgtatccatacagctcactttcagtattcgctctacacccgctttatttgagcttg
gaagccatgactgaaagattgcctcaagaactccaggacgagatttcccaagcaagaaag
aagctcgatctaaaggatgttgactatgaaggaaccatgaagacaaagctgtctatagct
aaaaagatttttcacatagaaaaagaagccgcatttaattcctcaaagtttaagacttac
tttgacgaaaataagcactggttagaaccatttgctgctttttgctttttgcgtgacctt
ttcgacaccgctgatcattctcaatggggccgcttttcaacattttcgcctgaaaagcta
gaaaagcttgtgtctccttcttctgaccattacaacttgatctctttcacatactttctt
cagtatcatcttcattctcagctcactgaagcgtctgagtacgctcgaaacaatggcgtt
gttttgaaaggagatcttcccattggtgtcgatagaaacagtgtggatacatgggtgttt
cccacattgtttcgaatgaatacatcgacgggtgctcctccagactatttcgataagaac
gggcaaaactggggatttcctacttacaactgggaagaaatgtccaaagataactttgca
tggtggagagctcgtttaactcagatgtccaagtacttcacggcttacaggattgatcac
attctaggattttttcgcatctgggagctgcctgcgcacgctgttacaggtcttatgggc
aagtttcgaccgtcgcttccattgacgcaggaagagctggaagcacaaggaatttgggat
ttcaatcgtcttagcgaaccatacgttcgatgtcatactttgcaagcaaaatttggagac
gcgtggtctgagattgcgtccaagtattttgatgagtacgaacatttgtgctacaagttc
aagaaagagcacgatacagaaaggaaaattcttggagctgttagtcaacttgaagattcg
aaaaagcaggaacaaatcaagggtgcattgttcgaccttctacgtgacgttgtcttgatg
agggacccagaggacagtagaaagttctatccgagatttggaatggagaacacatcaaat
ttcaaggagcttgacgagcacagcaagaacgtcttgcagagattgtactatgactacttc
tatcacaggcaagaaggcctctggcgcgaaaacgctttaaaaacgcttccagttttaatg
agctcttctgaaatgctaacttgtggagaggaccttggaatggtcccagcatgcgttgct
ccggttcttaacgagcttggcctgcttggactgaggatccaacggatgcccagcactcca
ggccaggagtttggcaatccactggaatacgaatacatgacggtgtgtgcaccttcgtgt
catgactgctcgactatgcgtgcttggtgggaggatgacgaaggcagacgaatccgattc
tacaaagactatctgggaatgagtgagtcccctcctgctcagtgcttaccagatgttgcg
cgagttataatcgaacaacacatgaaatcgccgtcaatgtgggccattttccctctccag
gaccttcttgctctcaaggaggagtatacaggccgaccggccaacgaggaaactatcaac
gatccaacgaatccaaagcattactggagattcagtaagtcaatgcttgttttgttttgc
cgagatttctga

DBGET integrated database retrieval system