KEGG   Selaginella moellendorffii: SELMODRAFT_429199Help
Entry
SELMODRAFT_429199 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
smo  Selaginella moellendorffii
Pathway
smo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:smo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SELMODRAFT_429199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:smo03041]
    SELMODRAFT_429199
Enzymes [BR:smo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SELMODRAFT_429199
Spliceosome [BR:smo03041]
 Complex C
  Other components
   Step II factors
    SELMODRAFT_429199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 HA2 OB_NTP_bind Sugar_tr Helicase_C DEAD AAA_22 AAA_19 AAA_30 MFS_1_like MFS_3 FtsK_SpoIIIE DUF2075 PhoH ABC_tran
Motif
Other DBs
NCBI-GeneID: 9658551
NCBI-ProteinID: XP_002990848
JGI: 429199
UniProt: D8T5D1
Position
Unknown
AA seq 1141 aa AA seqDB search
MAASKSPGRFKQRNAIAPHSQQASARRKSIEEQRRALPITIARQKLVDEVHKNDTLVIIG
ETGSGKTTQLPQFLLRAGFSKRGKMIGITQPRRVAAVTVATRVAEEMGSELGREVGYSIR
FEDATSDLTRIKYMTDGMLLREALLDPLLRKYGVIVIDEAHERTVHTDVLLGLLKGVQAK
RTEEHGPKKESLKLIVMSATLDAQGFSAFFNNAKIVYIQGRQFPVEIFYTFTSEADILDA
SLITLLQIHTEEEPGDILVFLTGQEEIESMDRLIHDRLPRLPPGSLKIQVVPIYAALPSE
QQVKAFIPAPPGTRKVILATNIAETSVTIPGIRYVVDPGLVKSRSYNPRIGLESLIVVPV
SKAQALQRRLVYHVTRFAFPRPGKCYRLYMEETFKQLENATVPEIKRCNLASVVLQLKAL
GIDDVLGFDFMDKPPKMAILKSLEHLYILGALTDEGKLSDPVGIQMARLPLEPLYAKALL
ISANFNCSKEMLSAVAMLSVESIFFVPKDKKKEADAAKQRFLSGDGDHITLVSVMRAFTD
EVNKSGGGVVSKKQILRWCIENYINMRSLKRAVDIYRQIEGCIQAINLPVVSCGEDFTSF
RRCLAAAFFLNAACLQQDGTYRIALRTLANTQVVSIHPSSIMHGKKLDCVVFNELVKTNK
QFIRNVTRIDSLWLPELAPHFYGTRDARRGEWPYRHRNNFRNLNLGVLRSFATALPIAVI
FPFLYFMVQDFHVTKSDADIGYFAGWIGSSFMAGRALTGILWGTIADKYGRKPVIFCGIM
SIIVFNTLFGLSKSFWMALTTRFLLGTFNGLLGTMTAYATEICSEEHVPFSVSLVGSMWG
VGLILGPALGGYLSQPAIKYPGVFAGTIFDSYPYFLQALVITIYAVMVLAQLAQLPETLH
KHEVFANDGKAGAYDPKESLLKNFPLISSILVYCIWAFHDIAFSEVGRSACTTLMEFRAD
ILPVGSESQTHGWSRLDEYRRWTSARSLGYGYNKQSGNIPCYISITYQALSIPLLVLLPS
LTSLEDTWLRVVVTVIAILKCCLGSAASTAAFLLVNNSVVKAQRGAANGLSLSVVSLFRA
LGPAVGGSVFAFAQTRPHASILPGDQLLFFFLGATAFISVLSTFPPFLPQSTNKPIIEDD
F
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccaaatcgcccggccgattcaagcagcgcaatgctatcgcgccgcattcg
cagcaagctagtgccaggaggaaatcgatcgaggagcagcggcgcgcgcttcctatcaca
atcgctcggcagaaattggtggacgaggtccacaagaacgatactcttgtgatcatcggt
gagactggaagtggaaaaactacgcaacttccgcagttcttgcttcgtgccggcttttcc
aagcgtggaaaaatgattggaatcacgcagccgaggagagtagctgctgttactgtggct
actcgtgttgcggaagagatgggaagcgagctgggacgtgaagttggatactcgatccgg
ttcgaggacgcgacgtccgacttaacgaggatcaagtacatgaccgacggaatgctcctc
agggaagctctgcttgatcctttgcttcgaaagtatggcgtaattgtaatagacgaagct
cacgaaagaacagtacatactgacgttctcttgggacttttgaaaggcgtccaagctaaa
cgcacagaggagcatggaccaaagaaagaatcgctcaagcttattgttatgtcagctacg
cttgacgcgcaagggttctcagcttttttcaacaatgcgaagatagtctacatacaagga
cggcagtttccagtggaaatcttctacacttttacgtccgaagcagacatcttggatgcg
tcattgataacgttgctccagattcatacggaagaagaaccaggagatatacttgttttt
ttgacgggacaagaagagatcgagtctatggataggctgatacacgatcgactgccacgc
ctccctccaggatcattaaaaattcaagtagttcctatatatgctgctttacccagtgag
cagcaagttaaagcttttattccagcaccacctggaacccgtaaggttatcttagccacc
aacattgcagaaacttctgtaactattccaggaatacgctacgtcgtagatcctggtcta
gtaaagtcccggtcctacaatcctcgcatcggtctggagtcgttgatagttgtgccggta
tcaaaagcgcaagctcttcagcgaaggttggtctaccatgtcactagatttgcttttcct
agacctggcaagtgctacagattgtatatggaggagacattcaagcagctcgagaacgct
actgttcctgaaatcaagcggtgcaatcttgctagcgtcgtgttgcagttgaaggcgctg
ggtattgacgatgttctcggcttcgatttcatggacaaaccaccaaagatggccatattg
aagtccctcgaacacttatatatattgggagcactgacagacgagggaaagctttcagat
ccagttggtatccagatggctcgcctgcctctggagcctctctacgcaaaagccttactc
atctcagcaaactttaattgtagcaaagagatgctatccgctgtcgcaatgctttctgtc
gagtcaatcttcttcgtaccaaaagataaaaagaaagaggcggatgctgcaaaacaacga
tttttgagcggagacggtgaccacataactcttgtcagtgttatgcgcgcctttacagat
gaagtaaataagagcggaggcggcgtggtttcgaagaagcaaatccttcggtggtgcatc
gagaactatatcaatatgcgttctctaaagcgtgccgtggatatctataggcaaatcgaa
ggttgcatacaagcaattaacctgcctgtggtttcatgtggagaggacttcaccagcttt
cgcaggtgtttggcagccgcattctttttaaatgcagcctgtctacagcaagatggtacc
tacaggattgctctcagaacgctggcaaacactcaagttgtttccatccatccctcctca
ataatgcatgggaagaagctggattgcgtcgttttcaatgagctggtgaagacgaacaaa
cagttcattagaaatgtgacgaggatcgactctctgtggcttccagagcttgcaccccac
ttctatggtacccgagatgcgcggcgtggcgagtggccttatcgtcaccggaacaatttc
aggaatttaaatttgggggttttacgatcgtttgcaacagcgctgccaattgccgtcatc
ttcccgttcttgtacttcatggttcaggactttcatgtgaccaagtcggatgctgatatc
ggatactttgctggatggatcggctcgtctttcatggctggaagagctcttactggaatc
ttgtggggaactatcgccgacaaatacggcaggaaacccgttatcttctgcggaatcatg
tcaatcattgtcttcaacacattgtttgggctgagtaaaagtttctggatggctctgacg
acccgtttcctgctgggaactttcaatgggctgcttggaacgatgacggcctatgctact
gaaatttgcagcgaagaacacgttcccttcagcgtgtcacttgtcggatcaatgtgggga
gttggacttatactcggtcccgcattggggggctacttgtcacagcccgctataaagtat
cctggagtttttgctggcaccatttttgatagctacccatatttcctccaagctctggtt
attaccatctatgcggtgatggtgctcgcccaactcgcccagctacctgaaacacttcac
aagcacgaagtgtttgcaaacgacggtaaagctggagcctatgatcctaaggagtccctg
ctgaaaaactttccattgatatcttccattttagtgtactgcatctgggcgttccacgac
attgcgttttcggaggtgggtcgaagtgcctgtaccactctcatggaattccgtgcagac
attctccctgtgggcagtgagtcccaaacgcacgggtggtctcggctggacgagtacaga
cgttggacaagcgctcgctctctcgggtatggttacaacaaacaaagtggaaacatccct
tgttatatttccatcacttaccaggcattgtcaataccactactggtcttgctgccgtct
ctaacaagcctcgaagatacgtggctgcgagttgttgtgactgtaatagccatactcaag
tgctgccttggctcggcggcctcaaccgcggccttcctcctagtcaacaattccgttgtg
aaagcacagcgaggagctgcgaatggtctttccctgagcgtcgtttccctcttcagagca
ttgggaccagcggtcggaggctcagtttttgcgtttgcgcaaactcgcccccatgcatca
atacttcctggcgaccagcttttgttcttcttcctgggcgcaaccgccttcatctcagtc
ctctcaacctttccaccatttttgccacaatcgaccaacaagccaatcatagaagacgat
ttttga

DBGET integrated database retrieval system