KEGG   Selaginella moellendorffii: SELMODRAFT_429514Help
Entry
SELMODRAFT_429514 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
smo  Selaginella moellendorffii
Pathway
smo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    SELMODRAFT_429514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 9635105
NCBI-ProteinID: XP_002991170
JGI: 429514
UniProt: D8T6F3
Position
Unknown
AA seq 428 aa AA seqDB search
MAFRRVISLPSMPPRVLTLTPSTFLSGRVKSNPTFFCRSSSSSGSFESKKWQGRWNNERW
GVGDPITQLAAKPVGVELTAFPEAEVDSTWGNLTHALSVLFCASINFLELPTTFLGPWFS
SRPEANRTGGGGAFDAPGMKRVVKGKKWSKSLMTRYGALPREALCRTPRLTPWLTLLPCR
DKAGLTTLLDRQTIYSGMYHSQRLLITSGDFDRDEEGTTLEQVVFRKLQDWTLSSMFGSK
LVGKCPLATTSSVYLELEKSLAKHLAGDLSEETGINFADSRVFSLSPAPSRVLASSSRSL
FLAHTASLISASLGQPRWIGLRLGLSSTQAGPWLAAGMQGDPSSFRFGQMMVLPGTVTLQ
ASRQPRMIPRFRAVLGASTPHIHHPFLSRTGNSILRQLKWTKFSMCLVGLGESNKPAFSR
RDCRPARA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccttcagaagagtgatctcattgccctccatgcctccaagggtgctaactcttact
ccaagtacgtttctcagtggtcgggtaaaatcgaaccctactttcttttgtcgatcttcc
agctcgtctggaagtttcgaatcaaagaaatggcaagggcgatggaacaacgagcgctgg
ggcgtgggcgatccgatcacgcagctcgccgccaagccagtgggagtggagctcacggca
tttccagaggcagaggtggattcgacgtggggaaacctcacgcacgctctctcggtcctc
ttttgcgcatcgatcaacttcctcgaattgccaactacgttcttggggccgtggttctcg
tcgaggcccgaggcaaaccggacaggaggaggaggagcttttgacgctcctggcatgaag
agggtggtgaaaggaaagaaatggagcaagagcttgatgacgaggtatggagcactccca
agagaagcactctgtagaacgccacggctcacgccatggctcacgcttctcccatgtaga
gacaaggctgggctcacgacgctcctggacaggcagacgatttacagtggtatgtaccat
tcccagaggctgcttatcacttctggtgacttcgatcgggacgaagaaggcacgacattg
gagcaggttgttttccgaaagctgcaagactggacactctccagcatgtttggctcaaag
ctggtaggcaagtgcccgcttgcaactacaagtagtgtctatctggagctggagaagagc
ttggcgaagcacttggctggagatctcagcgaagaaacaggcatcaacttcgcggacagt
cgtgttttcagtctcagccctgctccaagtcgggtgctcgcgtcctcttcacgctctctt
tttctggcacacacagcgagcttgatctcggcatcacttggacagccccggtggattggt
ctccggctcgggctcagttctacacaagctggtccttggctggcagcgggaatgcaaggg
gatccatcgtcatttcgtttcgggcaaatgatggttcttcccgggactgttactctccag
gcatcgaggcagccgaggatgataccgaggttcagggctgtgcttggagcatcgacgcca
cacattcaccatccattcctgtcacgaacaggcaattccatcctcaggcagctcaagtgg
acgaagttctccatgtgcctggtgggtttgggggaatcaaacaagcccgctttttctcgg
agagactgccgtcctgcccgagcttga

DBGET integrated database retrieval system