KEGG   Selaginella moellendorffii: SELMODRAFT_430614Help
Entry
SELMODRAFT_430614 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smo01001]
    SELMODRAFT_430614
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     SELMODRAFT_430614
Protein kinases [BR:smo01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   SELMODRAFT_430614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo Kinase-like HxlR APH
Motif
Other DBs
NCBI-GeneID: 9661566
NCBI-ProteinID: XP_002992381
JGI: 430614
UniProt: D8T9Y7
Position
Unknown
AA seq 256 aa AA seqDB search
MTVWRAVETAAKSFERSGEREKEIMLKLNGCHGTLEIYDMVEEERKGRWWGSLILELCSC
TLRDRLKMVGRLADDEAAFVTKSLAETLREMHNLGVVHRDMKLENVLLTHPAQPYEVKLS
DFGVATDRADEMHHLCGTPGYMSPDVLRAGEGGWPKYYTQAVDVWGLGLILYELLSGRVA
FPEYHSDYVELLLKSVDNVEFALDWSDVTSEAKDLIMGMLEVYPSRRLTVEQVLGHPWIV
NNTSELFTRNFICKIM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgtggagagcggtcgagactgcggctaagagcttcgagaggtcgggtgagaga
gagaaggaaatcatgctcaaactcaacggttgccatggtacactagagatctacgacatg
gtcgaggaggagcgcaagggccgctggtggggatccctaatcttggagctctgctcgtgc
acgctccgggacaggctcaagatggtggggaggctggcggatgacgaggcggcgtttgtg
accaagagcctggccgagacgctgagggagatgcacaaccttggggtggtgcacagggat
atgaagctggaaaacgttttgctgacgcatccagcgcaaccttacgaggtgaagctgtct
gactttggggttgcgactgaccgggccgacgagatgcaccacctttgtggcacccctggg
tatatgtcgccagatgttctcagggctggtgagggcggatggccgaaatactacactcaa
gcggtggacgtttgggggctcggactcattctatatgagctccttagcggaagggtggcg
ttccctgagtaccactctgattatgtggagttattgctgaaaagcgtggacaatgtggag
tttgcattggattggagtgatgtgacgagcgaggcaaaggatttgatcatggggatgttg
gaggtttatccgagccggaggctgacggtggagcaagtgcttggtcacccctggatcgtg
aacaacaccagcgagctgtttaccaggaactttatttgcaagattatgtaa

DBGET integrated database retrieval system