KEGG   Selaginella moellendorffii: SELMODRAFT_441909Help
Entry
SELMODRAFT_441909 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
smo  Selaginella moellendorffii
Pathway
smo00860  Porphyrin and chlorophyll metabolism
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SELMODRAFT_441909
Enzymes [BR:smo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SELMODRAFT_441909
Exosome [BR:smo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SELMODRAFT_441909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 9637002
NCBI-ProteinID: XP_002972677
JGI: 441909
UniProt: D8RNN6
Position
Unknown
AA seq 418 aa AA seqDB search
MALLLPGGIATPGLVWKQRRRASICKASAAPSPDPAWRTNVVSERAARSGVEIPRSIEEC
EAAVVSGNPPEAPPVPAKPKAPQGTPLVTPLRLSSRPRRNRKSAALRAAFQETTLTPANF
ILPLFIHEGEQDSPIGAMPGCFRLGWKHGLIDEVYKARDVGVNSVVLFPKIPDALKSATG
DEAYNPNGLVPRAIRILKDKYPDLVIYTDVALDPYSSDGHDGIVREDGVIMNDETVHQLC
KQAVAQAEAGADVVSPSDMMDGRVGAIRTALDEAGYHDVSIMAYTAKYASAFYGPFREAL
DSNPRFGDKKTYQMNPGNYREALLEVHADESEGADILMVKPAMPYLDVIRLLRDTSALPI
SAYQVSGEYSMIKAAASQGMLDEKKAVLESLLCIKRAGADVILTYAALQAARWLCGEK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacttcttcctggcggcattgccactccggggctggtttggaagcagcggagg
cgcgcatcgatctgcaaggcctccgcggcgccatcgcctgatccggcgtggaggacgaat
gtagtctccgagagggctgctagaagtggtgtggaaatcccgcggagcatcgaagaatgc
gaggctgctgtggtgtcggggaatcctccagaggctcctccggttccagccaagcccaag
gcgccacagggcactcctctggtcacgcccctgagattatcatccaggcctcgtcgaaac
aggaaatccgctgcgctgcgagctgcgttccaagagaccactttgacgccagcgaatttc
atactgcctcttttcatccatgaaggtgagcaggattcacccattggagcgatgcccggt
tgctttcgactgggatggaagcatggattgatcgacgaggtttacaaggctcgagatgtt
ggagtgaacagcgttgttctctttcccaaaattccagacgctctcaagtccgccacagga
gatgaagcgtacaatccaaatggccttgttccgcgagctatacgcattctcaaggataaa
taccccgacctggtgatctacacggatgtggcactggatccatattcatctgatggtcac
gacggaattgtgagagaagatggcgtgatcatgaacgatgaaactgtccatcaactatgc
aaacaagctgttgctcaggctgaggctggtgctgacgttgtgagcccgagcgatatgatg
gacggtcgtgttggtgcgattagaacagctttagatgaagctggataccacgacgtatcg
atcatggcatacaccgccaagtatgcaagcgcgttctatggtccattcagagaagctttg
gactcaaatccccgttttggagataagaaaacataccagatgaacccaggcaactacagg
gaggctcttctcgaagtacacgcagatgaatccgaaggcgcagacatactcatggtgaag
ccggctatgccatacctcgacgtgatccgacttctacgtgatacatcagcacttcccatt
tcagcttaccaggtttctggagagtattctatgatcaaggcagcagcatcgcaaggcatg
ctggacgagaaaaaagcggttttggagtctctactttgcatcaagcgagctggggccgat
gtcattcttacttacgccgcgttgcaagcggccagatggttgtgtggtgagaaataa

DBGET integrated database retrieval system