KEGG   Selaginella moellendorffii: SELMODRAFT_444049Help
Entry
SELMODRAFT_444049 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smo03036]
    SELMODRAFT_444049
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     SELMODRAFT_444049
Chromosome and associated proteins [BR:smo03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    SELMODRAFT_444049
   microRNA pathway
    RISC loading complex
     SELMODRAFT_444049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 Dicer_dimer DEAD ResIII PAZ Helicase_C CLASP_N T2SSE
Motif
Other DBs
NCBI-GeneID: 9659547
NCBI-ProteinID: XP_002979043
JGI: 444049
UniProt: D8S6V8
Position
Unknown
AA seq 1686 aa AA seqDB search
MAGGIVKKNQQQQQAPAVLGKINDENRPPVQEVEYILSRDLKPLKDPETQLKVGFYGADL
WGCAFLLTALLVADPGSKARLRRLAHRVRGAESSAPDLHLPVGFAPPRAVSGSRSDISDW
WIDDRCRRRRENVMTLVLKAVKNPRSALCKTAIMACSDLFQAFQDQVLEMLDPLLLQLLL
KASQDKKFVCEEAEKALLGMTTWISPVSLIHKLQPYTTHKNPRVRAKSATCISKSVAKLG
AEGIRDYGLEALMQIAAAQLIDQLPEARESARKLVVELHSAFQQQPDVSSNLSETSSSSS
GSDSDDQNQKSWEEFCSSILTPAVAQPILRVSTRAFQTGVFGVMDCAKRAKTMIPRGYQK
DVFQRALKENIIVNLGTGTGKTMIAIMLIQSFEDRLSMPQEKRIAVFLAPTVNLVIQQAR
AIESFTVLKVGDYYGDKGVDSWSVKQWQAEVDSHQVLVMTPQVFLNALGTSALKLEFVEI
LVMDECHHAHKNHPYALIMKTHYHVSCLKSKPKIFGMTASPVIQKGVSSSYDCNCKLTVL
ESILDAKVYTVEDKSEIEEYYPNPTQYKEYYDRPKQSFSSIQTDLEILKDRLNSEAACNC
SEYEQQNKINKSIDRLLLSINHCLVDLGLLPALLAVEILKSRNKSTFHLKWKPDVSLEEE
EVKTSLKERFLQNVSSIPRFSQVSSRSYPTLEEMTSGTLSPKVLVLLDVLERLRGMTNMR
CIVFVERVIVAMALAKLISGLSFLSHLRCDYMTGVRDTDARNPTQQQEVLHSFAGGKLNL
LIATSVAEEGLDVQACCAVIRFDVCQTLRSHVQSRGRARNLLSTYVWLLETGNVEQLNLF
NQLCTSERVVEDQVIFRNYMDITREAPPEGDLEFFRVESGACKSSQDSVSFIHEYCARLG
DRYYNAKPKFSFKDSFVCTVEFPPNAPLRSVEGPLRRTEQLAKKAACLQACRKLYDMGEV
RRDTLCPDVDDFDEEDQPMRKNESGKRKEIFSTAKPLIFEGSWVFNESGVQLQFYKICFV
VEPPESRTYSNFGFLVNCVIDAEVTDSEVTLFSRNRVVNARVHRVGPIQLDANQVKAAKA
YQELLLNGAFNRLARCSGSPQEILWDKSQAFLVLPVHDDNDSIDWTSVHATAWVYRTLCS
NFSPSSPMDGDGVGEKTHADMLCTANGYVHSSALQDMVVATVHNGRLFCVTGVLENFTAA
SLLPKRGFTYIDYYKDKYQRTLRLPEQPLLKAKPTHAFHNLLIRPKEQEGSRQEESFVEL
PPELCLCLEIKSGLIRSLYFVPSFLHRFTSTVCAIQLRSPLWPWIPAAKILEAITSKKCH
EEFSYESLELLGDSFLKYVVTQKLFLVYDKKHEGQLSARRSRATCNAALYQLAKSSGIAE
YIRDEEFNPSNWTGPGMLTSDSSKCRHQQGSFENEENYFSSCASGHRGIRRKALADVVEA
LIGAYLATSGPPSAMELMKQLDIDIEFDIGLLASARQASLPAESFQHLQASLESLEHKLQ
YKFQNRSLLVEAITHASQPNCLLCYQRLEFLGDGVLDFLVSRHLFETHPGLPPGTLTDLR
SAAVNNKWFARLVVRHGLHQHLQHGSVELDCEIRKFVQNVKEKPDASCFEDLSAPKVLGD
LLESITGAIFVDTNFDLERLWRVVLPFVIASGHSSDAAFPSCAHSHGALREKRHDSQFLP
DRGDHD
NT seq 5061 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggaatcgtcaagaagaatcagcagcagcagcaagcgccagcggttctaggc
aagatcaacgatgagaatcggccgccagtgcaagaagtggagtacattctttccagggat
ctcaagccgctcaaagatcccgagacgcagctcaaggtagggttctatggcgcagatcta
tggggatgtgcattcttgctcacggcattgctggtggcagaccctggcagcaaggctcgg
ctccggagattggctcaccgtgtgcgcggcgctgaatcaagtgcgccagatctccatctt
ccagtcggatttgctcctccccgtgctgtgagtggttctagatctgatatttcggactgg
tggattgatgatcgatgccgccgccgcagggagaatgtcatgaccctagtcttgaaggcc
gtgaagaatcctcgcagcgcgctgtgcaagacggcgattatggcatgctcggatttgttc
caggcgtttcaagatcaagtgctcgaaatgctcgatcctctgttgctccaactattgctc
aaagcatcacaagacaagaaattcgtttgcgaggaagccgaaaaggctctcttgggaatg
actacctggatatcgcccgtctctttgatccacaagctccagccgtatacgacgcacaag
aacccccgcgtccgtgcaaagtcggcaacatgtatctccaagagcgtcgccaaactcggc
gccgaaggcatcagggactacggattggaagctttgatgcaaatcgccgctgcgcagctc
atcgaccagctccccgaggctcgcgaatccgctcgtaagttggtggtggagctccactcg
gccttccagcaacagccggacgtgagctccaatctctccgagacgagcagcagcagcagt
ggcagtgactccgacgatcaaaaccagaaatcctgggaggagttttgttccagcatcctc
actcccgcggtggcgcagccgattcttcgcgtcagcaccagggcttttcagacaggggtt
tttggcgtcatggattgcgcgaagcgggccaagacgatgatcccgcgcggctaccagaaa
gatgtgttccagagggcattgaaggagaatatcatcgtcaatctcggcactggaacgggg
aagacgatgatcgcgatcatgctcatccagagcttcgaggacaggctgtccatgccccag
gagaagcgaattgcggtgtttctagcaccaacggtgaatttggtgatccagcaagctcga
gctatagaatcctttacggtgctcaaggtcggtgactactacggtgacaaaggagtcgat
tcttggagcgtcaagcaatggcaggcggaggtggattctcatcaagttctggtgatgacg
cctcaggtgtttttaaatgcgctcgggacttctgcgctgaagctcgagtttgtggaaatc
cttgtcatggacgagtgtcatcacgcccacaagaatcatccatacgcgctgattatgaag
acgcactaccacgtttcttgtctcaaatcaaagccaaagatatttggaatgacagcttct
cctgttattcagaaaggtgtatcatcaagttatgactgcaattgtaaattaacggtctta
gaaagcattctggatgccaaggtgtacacagtggaagataagtccgaaatagaagagtat
tatccgaatccgacacaatataaggagtactatgacagaccgaaacaaagcttctccagt
atacaaactgatctagaaatactaaaagaccgcctaaattctgaagctgcgtgtaactgt
agcgaatatgagcagcagaacaaaataaacaaatctattgacagacttcttctgagcata
aaccactgcctcgtagacctgggccttctacctgcgcttctggcagtggagatactcaag
agtcgcaacaaaagtacttttcatttaaaatggaagccagatgtctcgttggaggaggag
gaggtgaaaacgagcttgaaagagcgtttcttacaaaatgtttcttcaataccaaggttt
tctcaagtatcttcgcgctcttatccgaccttagaggaaatgacttcaggaacattaagc
ccgaaagtactggtactattggatgtgcttgaaagattgaggggcatgacaaacatgcgt
tgcattgtctttgtggaacgtgtgattgtggccatggccttagccaagctcatatctggg
ctttcgtttctttctcatctccgttgtgattatatgactggtgtgcgtgatacggatgca
agaaatccaacccagcagcaggaggttctacactcttttgcaggtggcaagcttaatctg
ctaatagcgacctcagttgcagaagaaggtcttgatgtccaggcatgctgcgctgtaatc
agatttgacgtatgccaaactttgcgaagccatgttcaatcccgaggacgtgctcgaaac
ctattatcaacttacgtatggcttctggaaacggggaatgtagagcagctgaacctgttc
aaccagttgtgtacaagcgaaagagtggtggaagatcaagtaatcttccgaaattatatg
gatattacgagagaggcacctccagaaggtgacctggagtttttccgtgtggaatcaggt
gcttgtaaaagttcgcaggacagcgtgagcttcattcacgagtattgtgctcgtcttggt
gacaggtactacaatgcaaaaccaaagttttcgttcaaagattcgttcgtctgcactgtg
gaatttccacccaacgctcctctgcgttcagtagaaggtcctctaagacgtacagaacag
ctcgcgaaaaaagcagcgtgtttgcaagcatgccggaaactttatgacatgggagaagtt
agacgtgacacgctttgcccagatgttgacgatttcgatgaagaagaccagccgatgcgg
aagaatgaatcaggaaaacgcaaggagatcttctcgactgcaaagccactcattttcgag
ggaagctgggtgtttaacgagtcaggggtgcagttgcagttttataaaatctgcttcgtg
gttgagccacctgaatcacgaacatactcaaactttggatttctggtaaattgcgtcatt
gacgcagaagtaaccgattctgaagtgaccctgttctcaagaaatagagttgtcaacgct
agagtacatcgcgtcgggccaattcagctggatgccaatcaggtaaaggcagccaaggca
tatcaagagctactgctcaacggagctttcaaccgtttggcacgctgctcgggaagtcct
caagaaatcctctgggacaaatctcaagcgtttcttgtgctacctgtgcatgatgacaac
gatagtattgattggacgagtgttcatgcgactgcgtgggtatacaggacactttgtagt
aatttctcaccatcttctccaatggatggggatggtgtgggggagaagacgcacgcggac
atgctctgcactgccaatggctacgtacattcttctgcgctccaggacatggtcgtagct
accgtgcacaatggcaggcttttctgtgtcacaggggttctagagaattttactgcggca
tcactactaccgaagagaggcttcacgtacatagattattacaaagacaagtatcaaagg
acgttacggcttccagagcagccattgctgaaagccaagcctacgcatgcttttcataat
ctcctcataagacccaaggaacaagaaggttctagacaagaagaaagttttgtagagcta
ccacctgagttgtgcctgtgcctagagattaagtccggactaattcgatcgctatacttc
gtcccttcgtttcttcaccggtttacttcgaccgtctgtgccatacagttgcgctcacca
ctgtggccatggattcctgcagcgaagatcctcgaagcaattaccagcaaaaaatgtcac
gaagagttctcatatgagagtttggagcttctaggggactcgtttctcaaatacgtcgtg
actcaaaagctgttcctggtctacgataagaaacacgaaggccagctcagtgcgagaagg
tctcgcgctacttgcaatgcagcgctatatcagttggcaaaatcatctggcattgcggaa
tacatacgagacgaagaattcaatccttccaactggactggcccgggcatgcttacctct
gattcatcaaaatgtaggcaccagcaggggagctttgaaaacgaggaaaattatttttca
tcttgtgcgagcggccatcgggggattcgaaggaaagctctcgccgacgttgtagaggcc
cttatcggtgcatacttggccacctctggacctccgagcgccatggagcttatgaaacag
ctcgacattgacatagaattcgacataggcttgcttgcctcggctcgccaagcttccctg
ccggctgaatcgtttcaacatctccaggcctcgttggagtctttagagcataagctgcag
tataaatttcaaaacaggagcctcttggtggaagctataactcacgcatctcaaccgaac
tgcttgctctgctatcagaggctagagttccttggcgatggcgtcctggacttccttgta
tcccgccacctcttcgagactcatccaggattacctccaggaacactcactgacttgcgg
tctgcagccgtgaacaacaaatggtttgctcggctggttgtgaggcacggcttacatcag
catcttcagcatggctcggtggaacttgactgcgagatccgaaagttcgtgcaaaacgtg
aaggaaaaaccagacgcttcatgcttcgaagacttgtcggccccaaaggtgcttggagac
ttacttgaaagcataaccggtgccatatttgtggacactaacttcgatttggagaggttg
tggagagtggtgctgccctttgttatcgcctctggtcactccagcgacgctgcgtttcca
tcctgtgcgcattctcatggagctttgcgcgagaaaaggcatgacagtcagtttcttccg
gacagaggcgaccacgactga

DBGET integrated database retrieval system