KEGG   Selaginella moellendorffii: SELMODRAFT_445420Help
Entry
SELMODRAFT_445420 CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
smo  Selaginella moellendorffii
Pathway
smo00270  Cysteine and methionine metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SELMODRAFT_445420
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SELMODRAFT_445420
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SELMODRAFT_445420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_8 Cupin_6
Motif
Other DBs
NCBI-GeneID: 9654346
NCBI-ProteinID: XP_002983055
JGI: 445420
UniProt: D8SIG5
Position
Unknown
AA seq 186 aa AA seqDB search
MKAWYMDSSCEDQRLPHHLDPPQYVSEEHLSELGVLHWVMNADEYETDPQLKKLREERGY
DYEDFITVSPDKLPNYEHKIKTFYEEHIHTDEEIRYCLDGSGYFDVRDSDDRWIRIWVEK
GDMIVLPAGSYHRFTNDESNYIKAMRLFVGAPIWTPYNRPQDDHPIRQQYVSEIRRKSSG
AGIEAH
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctggtacatggacagctcttgcgaggatcagaggcttcctcaccatctggat
cctccgcaatatgtgagtgaggagcatctctcagaattgggggttttgcattgggtgatg
aatgccgacgagtacgagacggatccccaactcaagaagctccgcgaggagcgtggctac
gattacgaagatttcatcactgtcagccccgacaagctgccgaattacgagcacaaaatc
aagaccttctacgaggagcacatccacactgacgaagagattcgctactgtctcgacgga
agtggctactttgatgtgcgagactccgatgatcgctggatccggatatgggtcgaaaag
ggcgatatgatcgtcttgcctgccggtagttaccatcgcttcacaaacgacgagtcaaac
tacatcaaggcgatgaggcttttcgttggagctcccatttggacaccttataaccgacct
caagatgatcatcccatcaggcagcaatacgtctctgaaattcgcaggaaatcgtcagga
gcaggaatagaggcgcactag

DBGET integrated database retrieval system