KEGG   Selaginella moellendorffii: SELMODRAFT_449548
Entry
SELMODRAFT_449548 CDS       T01496                                 

Gene name
FK-2
Definition
(RefSeq) sterol C-14 reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
smo  Selaginella moellendorffii
Pathway
smo00100  Steroid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SELMODRAFT_449548 (FK-2)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SELMODRAFT_449548 (FK-2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9649024
NCBI-ProteinID: XP_002976488
JGI: 449548
UniProt: D8RZI0
Position
Unknown
AA seq 355 aa
DGYDRQGAALVGFLSLLALLEAVLPGQRVSGVELADGTRIIYKCNGLLSLVVLLALLGAA
VPPTVLADRGPELFSTTLTLCVLLSIVLCLAGYASKSPSSSLKCQSSGNALHDWWLGLQL
NPQFLSIDIKFFWIKAGMISWLLINFSIASKQIEQAGFLTLPMALYQVFCTIYVLDFLWY
EEYMTSTWDIIAEKFGFMLIFGDMVWIPFTFSIQGWWLLHNNAEITRMAAFLNALVFLAG
YAIFRGANKQKHEFKKNPKAPIWGKPPVLIGGKLLVSGYWGIARHCNYLGDLLLALSFSL
PCGTSSIVPYFYPIYLFILLVWRERRDEARCRAKYKAVWEEYCKAVPWRIFPRIY
NT seq 1068 nt   +upstreamnt  +downstreamnt
gatggttatgatcggcagggagcggctcttgtgggattcttgagcttgctcgcattgctg
gaggctgttcttcccgggcagcgcgtgtctggggtggaattggcggacgggacgcggata
atctacaaatgcaatggtttgctgtcgcttgtggtgctcttggcgctcctgggagcggcg
gttcctccaacggttcttgcggatcgtggaccggagctattctcgacaactttgacactt
tgtgtcctgctgtcgattgttctatgcctggctggctacgcatccaaaagtccaagcagc
tctttgaaatgccagtcttccggaaatgctcttcacgactggtggcttgggcttcaacta
aatcctcagtttcttagcattgacatcaagtttttctggataaaggctggaatgatcagc
tggctcctgataaatttttcaatcgcaagcaagcagatcgaacaggccggattcctgact
cttccaatggctttataccaagttttctgcacgatctacgtgctggattttttgtggtac
gaagaatacatgacctcaacgtgggacattattgcggagaagtttggcttcatgctaatt
tttggtgacatggtttggattccctttacgtttagcatccagggatggtggctgcttcat
aacaatgcggaaatcactcgaatggctgcatttttaaatgctcttgtcttcttggcaggg
tatgcaatatttagaggtgcaaacaagcaaaagcacgagttcaagaagaacccaaaggct
ccaatatgggggaaaccacctgttctcatcggaggaaaacttctcgtctctggatactgg
gggattgcaagacactgcaactatctaggcgatttgcttctggctttatcgtttagtctt
ccttgcgggaccagctcgatagttccatatttctaccccatctatttgttcattcttctc
gtctggagagagcgacgagacgaagcaagatgcagagccaagtacaaagctgtgtgggaa
gaatactgcaaggcggtgccatggagaattttccccaggatctattga

DBGET integrated database retrieval system