KEGG   Selaginella moellendorffii: SELMODRAFT_449602
Entry
SELMODRAFT_449602 CDS       T01496                                 

Gene name
FK-1
Definition
(RefSeq) sterol C-14 reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
smo  Selaginella moellendorffii
Pathway
smo00100  Steroid biosynthesis
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
Module
smo_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SELMODRAFT_449602 (FK-1)
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SELMODRAFT_449602 (FK-1)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9641688
NCBI-ProteinID: XP_002973419
JGI: 449602
UniProt: D8RQ46
Position
Unknown
AA seq 357 aa
MAWADLLQPPSAATFLSLLALLEAVLPGQRVSGVELADGTRIIYKCNGLLSLVVLLALLG
AAVPPTVLADRGPELFSTTLTLCVLLSIVLCLTGYASKSPSSSLKCQSSGNALHDWWFGL
QLNPQFLTIDIKFFWIKAGMISWLLINFSIASKQIEQAGFLTLPMALYQVFCTIYVLDFL
WYEEYMTSTWDIIAEKFGFMLIFGDMVWIPFTFSIQGWWLLHNNAEITRMAAFLNALVFL
AGYAIFRGANKQKHEFKKNPKAPIWGKPPVLIGGKLLVSGYWGIARHCNYLGDLLLALSF
SLPCGTSSIVPYFYPIYLFILLVWRERRDEARCRAKYKAVWEEYCKAVPWRIFPRIY
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcgtgggcggatcttctccagcccccctccgccgcaacgttcttgagcttgctcgca
ttgctggaggctgttcttcccgggcagcgcgtgtctggggtggaattggcggacgggacg
cggataatctacaaatgcaatggtttgctgtcgcttgtggtgctcttggcgctcctggga
gcggcggttcctccaacggttcttgcggatcgtggaccggagctattctcgacaactttg
acactttgtgtcctgctgtcgattgttctatgcctgactggctacgcatccaaaagtcca
agcagctctttgaaatgccagtcttccggaaatgctcttcacgactggtggtttgggctt
caactaaatcctcagtttcttaccattgacatcaagtttttctggataaaggctggaatg
atcagctggctcctgataaatttttcaattgcaagcaagcagatcgaacaggccggattc
ctgactcttccaatggctttataccaagttttctgcacgatctacgtgctggattttttg
tggtacgaagaatacatgacctcaacgtgggacattattgcggagaagtttggcttcatg
ctaatttttggtgacatggtctggattccatttacgtttagcatccagggatggtggctg
cttcataacaatgcggaaatcactcgaatggctgcatttttaaatgctcttgtcttcttg
gcggggtatgcaatatttagaggtgcaaacaagcaaaagcacgagttcaagaagaaccca
aaggctccaatatgggggaaaccacctgttctcatcggaggaaaacttctcgtctctgga
tactgggggattgcaagacactgcaactatctaggcgacttgctcctggctttatcgttt
agtcttccttgcgggaccagctcgatagttccatatttctaccccatctatttgttcatt
cttctcgtctggagagagcgacgagacgaagcaagatgcagagccaagtacaaagctgtg
tgggaagaatactgcaaggcggtgccatggagaattttccccaggatctattaa

DBGET integrated database retrieval system