KEGG   Selaginella moellendorffii: SELMODRAFT_57543Help
Entry
SELMODRAFT_57543  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
smo  Selaginella moellendorffii
Brite
KEGG Orthology (KO) [BR:smo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:smo03110]
    SELMODRAFT_57543
Enzymes [BR:smo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SELMODRAFT_57543
Chaperones and folding catalysts [BR:smo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SELMODRAFT_57543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 9657606
NCBI-ProteinID: XP_002980946
JGI: 57543
UniProt: D8SC54
Position
Unknown
AA seq 228 aa AA seqDB search
DTSITDRVFFNLGLCQSSNTPAGGRPTCSDSDSQPLGRVVIGLYGNQVPHTTRLIKAMAT
GAAGSSYQGTVFHKVIQGRYIQAGHQGSKEKGEVSPPSPDYLESNPDTVSPRSFLLRHSR
PGTVSLCLAENDDDESIRLNPDYRNVQSIFHLGPGPAPDLDNRNIVFGTVLQGIDIVASI
AAMPTFKPSDRVREFNNIAQILGDVRASNARSSWYRPVKPVLITSCGE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gacacgagcatcaccgatcgagtgttcttcaatctggggctatgccagagcagcaacacg
cccgcggggggccggccgacgtgcagcgattccgattcgcagccccttggccgtgtcgtg
atcggcctctacggcaatcaagtgccacacacaacccgattgatcaaggccatggccacc
ggcgcggcggggagctcctaccaaggcacggtcttccacaaagtgatccagggccgctac
atccaagccgggcaccagggatccaaagagaagggcgaggtttctccgccatcgccagat
tatctggaatccaaccccgacacggtcagtcccagatctttcctcctccgccacagccgt
ccaggaacggtgtcgctgtgcctggccgagaacgacgacgacgaatccatccggctcaat
ccggattatcgcaacgtccaatcgatcttccatctcggcccaggcccagctcccgacctg
gacaatcgaaacatcgtgtttggaactgttcttcaagggattgatattgtggcatcgatc
gcagccatgccgactttcaaacccagcgaccgagtccgcgagtttaacaacatcgcccag
atcttgggcgacgtccgtgctagcaatgccaggagttcttggtacaggcccgtcaagcct
gtgctcatcactagctgtggagag

DBGET integrated database retrieval system