KEGG   Selaginella moellendorffii: SELMODRAFT_75178Help
Entry
SELMODRAFT_75178  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
smo  Selaginella moellendorffii
Pathway
smo00480  Glutathione metabolism
smo00590  Arachidonic acid metabolism
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SELMODRAFT_75178
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SELMODRAFT_75178
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SELMODRAFT_75178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 9633033
NCBI-ProteinID: XP_002960665
JGI: 75178
UniProt: D8QP17
Position
Unknown
AA seq 171 aa AA seqDB search
MSSSDKPSSIYDITVNDATGNDVSLGSYKDKVLLIVNVASQCGFTTTNYKELNELYEKYK
DKGFEILAFPCNQFAGQEPGSNEEIQQTVCTRFKAEFPVFGKVNVNGADTAPVFKYLKSA
KGGGIFGDFIKWNFSKFLVSKTGEVVERYAPTTNPSKIEVNFLPRYSLSVH
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttcggataagccctctagcatctacgacattactgtcaatgatgctacagga
aacgatgtttctctcggcagctacaaggacaaagttctcctgattgtgaacgttgcatcg
caatgtggcttcactacaaccaattacaaagaactcaacgagctctacgagaagtacaag
gacaagggctttgagatcctggcctttccgtgtaaccagtttgccgggcaagagcctggc
tctaacgaagaaatccagcaaaccgtgtgtactcgattcaaggccgagttcccggttttt
gggaaagtgaacgtgaatggagcagacacagctcctgtttttaagtacctcaagtctgcc
aagggtgggggcatcttcggcgactttatcaagtggaacttcagcaagtttctggtgagc
aagactggtgaagttgttgagcgctatgctccaactacaaacccatccaaaatcgaggtc
aatttcttgccgcgctactctctttcggtgcactaa

DBGET integrated database retrieval system