KEGG   Selaginella moellendorffii: SELMODRAFT_80130Help
Entry
SELMODRAFT_80130  CDS       T01496                                 

Gene name
GntII
Definition
(RefSeq) N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
smo  Selaginella moellendorffii
Pathway
smo00510  N-Glycan biosynthesis
smo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    SELMODRAFT_80130 (GntII)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:smo01003]
    SELMODRAFT_80130 (GntII)
Enzymes [BR:smo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     SELMODRAFT_80130 (GntII)
Glycosyltransferases [BR:smo01003]
 Glycan extension
  N-Glycan
   SELMODRAFT_80130 (GntII)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 9655188
NCBI-ProteinID: XP_002963659
JGI: 80130
UniProt: D8QY16
Position
Unknown
AA seq 429 aa AA seqDB search
MVSSGRARPNLQHLLLAFLILISVVGILLSSSGFARFDTTPGGGRALGPIIVLKEALVQE
GVEIQEPAIVREPTNSSLWAQGRNALPPRNRELFPALARDHIIVVLYVHNRPQYLRVVIE
GLSRVDGINETLLIVSHDGFYPEMAELVEKIDFCQVKQLFAAYSPHLFPSSFPGTSPGDC
KNKDDPVAKKCEGQADQYGNHRSPRIVSLKHHWWWMMNTIWDGLPETRGYNRHIVFIEED
HYLFPNAYRNIQTLARITSERCPDCWAVNLAPWDVKNRGERGDFLVAEKIGNMGYGFNRT
MWNKLHSSAATFCHFDDYNWDITLWSSVYPSWDEKAYTLRGPRTSALHFGRCGLHQGHQD
GKPECQDFTQEGPQVDPEDRIMNIDPSWEVSRHVYNYPHKFTGWGGWGDRRDQKLCMEFA
SMYRHRHRL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcagcggcagggcgcgccccaatctccagcatctgctgctcgccttcttgatt
ctcatctccgtggtggggatcttgctcagcagctcgggcttcgccagattcgacaccacc
cccggcggcgggcgagccttaggtcccatcatcgtcctcaaggaggcgctcgtccaggag
ggcgtagagatccaggagccggccattgtccgtgagcccaccaattcctccctttgggcc
cagggaagaaacgcgctgccgcctcgcaacagggaactcttcccagcgctcgccagggat
cacatcatcgtcgtgctctacgtccacaaccggccacagtacctccgggtggtgatcgag
ggcctctcgcgcgtggacgggatcaacgagacactcctcatcgtcagccacgatgggttc
tatcccgagatggcggagctcgtcgagaagatcgacttctgccaggtaaagcagcttttc
gcggcctactcgccacacctcttcccctcgtccttcccggggacctctcccggcgattgc
aagaacaaggacgatccagtggccaagaagtgcgaggggcaggcggatcagtatggaaac
caccgcagcccgaggatcgtctcgctcaagcaccactggtggtggatgatgaacaccatc
tgggacgggcttccggagactcggggttacaacaggcacatagttttcatagaggaggat
cactacttattcccaaacgcgtaccggaacatccagacgctggccaggatcaccagcgag
aggtgcccggattgctgggccgtgaacttggccccctgggacgtcaagaaccggggcgag
cggggggactttctcgtcgccgagaagatcggaaacatgggatatggattcaaccggacg
atgtggaacaagctccactcgagcgccgccaccttctgccacttcgacgattacaactgg
gacatcacgctgtggtcgtcggtgtatccgtcctgggacgagaaggcttacactctccgg
gggccgaggacgagcgcgctacacttcgggcggtgtggcttacaccaggggcaccaggat
ggcaaacccgagtgccaggatttcacgcaggaggggccgcaagtggatccggaggaccgg
atcatgaacatcgatccgagctgggaggtctcgcggcatgtttataactatccccacaag
ttcaccgggtgggggggatggggagatcgcagggatcagaagctgtgcatggagtttgcg
tccatgtaccgccatcgccatcgcctctag

DBGET integrated database retrieval system