KEGG   Selaginella moellendorffii: SELMODRAFT_85852Help
Entry
SELMODRAFT_85852  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
smo  Selaginella moellendorffii
Pathway
smo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SELMODRAFT_85852
Enzymes [BR:smo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SELMODRAFT_85852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 FSH1 Abhydrolase_6 Abhydrolase_1 DLH Lipase_3 Esterase Peptidase_S9 DUF2974
Motif
Other DBs
NCBI-GeneID: 9633705
NCBI-ProteinID: XP_002966628
JGI: 85852
UniProt: D8R6E3
Position
Unknown
AA seq 237 aa AA seqDB search
EWGKTITIEPEGKHLVTVVWLHGLGDTGHGWASILKTLSLNNIRWIVPTAPVRPVTINNG
YPCTAWFDVGSLSDEGPDDILGLDSSAAYVASFLSKEPADVKVAVGGFSMGGATSLYTAA
HSVLGKYTDGKAFTRKIDAVMSLSGWLPAGKLLPKQVAETPDCLKLAAELPIFMAHGKND
FIVYHNFGEMSARALKECGFKNVTFKSYRGLDHSTTPEELDDLCEWIKQELSVPEKV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gaatgggggaaaacgataacaatcgagccggagggcaagcatctcgtcacggtagtttgg
ttgcatggtcttggggatactggccacggctgggcttccattctgaagacactttctcta
aacaatatcagatggatcgtcccgaccgcgcctgtccggcccgtaaccattaataatgga
tatccatgcaccgcatggtttgatgtgggatcgctctcggacgaaggaccagatgatatt
cttggcctagattcttctgctgcatatgttgctagctttctttccaaggagcccgctgat
gtgaaggttgcggtcggcgggtttagcatgggcggcgcaacatctttgtacactgctgct
cattcggttcttgggaaatacacggatggaaaggcatttactagaaagatagacgcagtc
atgtctctcagtggatggcttcctgcaggcaagttgttgccaaagcaagttgctgaaact
ccagactgcttgaaattggccgcggagcttccaattttcatggctcatgggaaaaatgac
ttcatcgtctatcacaacttcggcgaaatgtcggcgcgggcactgaaggagtgcgggttc
aagaacgtcacgttcaagtcttacagagggcttgatcactcgacgacaccagaggagcta
gacgacctttgcgagtggattaaacaagagctcagtgtccctgaaaaagtatag

DBGET integrated database retrieval system