KEGG   Selaginella moellendorffii: SELMODRAFT_85954Help
Entry
SELMODRAFT_85954  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
smo  Selaginella moellendorffii
Pathway
smo00230  Purine metabolism
smo01100  Metabolic pathways
Module
smo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SELMODRAFT_85954
Enzymes [BR:smo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SELMODRAFT_85954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase ATPase_2 adh_short GreA_GreB_N AAA_33 AAA_22
Motif
Other DBs
NCBI-GeneID: 9634045
NCBI-ProteinID: XP_002966691
JGI: 85954
UniProt: D8R6R1
Position
Unknown
AA seq 217 aa AA seqDB search
MTQLEEALGTPFDVGPQVPAPKPLVIVISGPSGVGKDSVIKRLQEVRKEIHFVVTATSRQ
KRPGEVHGVDYYFVSKEEFEEMIDKKELLEHALVYGDYKGIPKKQVRDCLAEGKDVVLRV
DVQGAATVRSILGSNAVFIYIVAESEFALVKRLIERKTESMEKLVVRVATARDELKRLEE
FDYAVVNSDGQLERSVNAICGIIDAEKSRVIQKLASI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctcgaggaggcactggggacgcctttcgatgtcgggcctcaagttcccgca
ccaaagcctctggtaattgtcatcagtggcccaagcggtgttggcaaagactctgtcatc
aagaggcttcaagaagtgaggaaggagatacatttcgtggtgaccgccactagcaggcaa
aagcgtcccggagaagttcatggtgtcgactactacttcgtcagcaaggaagagtttgag
gagatgattgacaagaaagagctcttggagcatgcgctggtctacggagattataaaggg
attcctaagaaacaagtgcgagattgcttggccgaagggaaggacgtcgttttgagagtt
gacgtccaaggagctgccacagttcgctcgatactcggctccaacgccgttttcatctac
atcgtcgcagagtcggagtttgctctggtgaagagactgatagaaagaaagacggagagc
atggagaaactggtggtgagagtagcaaccgcaagagacgagctcaagagactggaagag
tttgattacgcggtggttaactcggacgggcaactagagagatcagtgaacgccatatgc
gggatcatcgacgcggaaaagtctagagtgattcagaagctggcaagcatctaa

DBGET integrated database retrieval system