KEGG   Selaginella moellendorffii: SELMODRAFT_87880Help
Entry
SELMODRAFT_87880  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
Organism
smo  Selaginella moellendorffii
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 9635374
NCBI-ProteinID: XP_002967344
JGI: 87880
UniProt: D8R7V3
Position
Unknown
AA seq 248 aa AA seqDB search
MRHLSLRHLRRQILFNRAMAQLGLCAFRTGLITETHACLSEFYAGGRVKELLAQGVQQSR
FYDKTPEQEKLERRRQMPFHMHINLELLEAVHLICAMLLEVPNMTANAHDVKKKVYSKTF
RRLLDIYEKQAFIGPPENIRDNIMAASRALMKGDWEKAVAIVQGLDIWKLLRKREFAMDM
LKSKIQEEVLRTYLFTYASSYDSLSLDQLMAMFDLPEGLVHSIASRLMAAEEFHGSWDQP
TRCLYVHF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatctatcactacgccatcttcgacgccagatcctgttcaacagagctatggcg
cagctgggactgtgtgccttccggaccggtctcatcactgaaacgcatgcgtgcctgtcg
gagttctatgccggcggacgggtgaaagagctccttgcacaaggagttcagcagagtcgg
ttttacgacaagactccagaacaggaaaaactcgaacgccgccgccaaatgccgtttcac
atgcatatcaacctggagctactggaggcggtccatctaatatgtgcaatgctgctggag
gttcccaacatgaccgccaacgcgcacgacgtgaagaagaaagtttacagcaagacgttc
cgccgtctcctggacatctacgagaagcaggccttcatcgggcccccagagaacatccgt
gacaacatcatggcggcgagccgggctctgatgaagggcgactgggagaaggcggtggcg
atcgtccagggcctagatatctggaagctgctccggaagcgagagttcgccatggacatg
ctcaagagcaagatccaggaggaggtgctgaggacttatctcttcacgtacgcatcgtct
tacgactcgctgagcctggaccagctcatggcaatgtttgatctcccggaggggctcgtt
cacagcatcgccagccggctcatggcagcggaggagttccacggcagctgggaccagccg
actcgctgtctttacgtgcatttttag

DBGET integrated database retrieval system