KEGG   Selaginella moellendorffii: SELMODRAFT_94736Help
Entry
SELMODRAFT_94736  CDS       T01496                                 

Definition
(RefSeq) hypothetical protein
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
smo  Selaginella moellendorffii
Pathway
smo00250  Alanine, aspartate and glutamate metabolism
smo00650  Butanoate metabolism
smo01100  Metabolic pathways
Module
smo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SELMODRAFT_94736
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SELMODRAFT_94736
Enzymes [BR:smo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     SELMODRAFT_94736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh SCAN
Motif
Other DBs
NCBI-GeneID: 9642763
NCBI-ProteinID: XP_002971376
JGI: 94736
UniProt: D8RJV5
Position
Unknown
AA seq 500 aa AA seqDB search
MATIASAGASQAVLDKINNAGLLRAKGLISGEWVSAEDGRTLPVYNPATGEFLTEVPLMG
ERETLSAIDSAHNAFKSWSKKTCSERSKLLRRWYELILEKKEEIAQLMTLEQGKPLKEAL
GEVSYGAGFIELFAEEAKRTYGDIIPSPYPDRRLLVVKQPVGVVGTITPWNFPLAMITRK
VAPALAAGCTVVIKPAELTPLTALAAAELSIQAGIPPGVINVVMGDAPQIGAALLESTKV
RKISFTGSTQVGKKLMAGAASTVKRLSLELGGNAPCIILDDADIEVAVKGALASKYRNSG
QTCVCANRVLVQDGIYDKFAEAFIQAVSGLKVGNGLEEGVTQGPLINEAAVKKVVEQHVE
DALSKGAMLLAGGHRHRLGAAFYEPTVLGDATEEMLIMKEEVFGPVAPLIRFKTDEDAIR
IANSTEAGLAAYLFSGSISRAWRVAEALEYGMVGWNEGVISTEVAPFGGVKQSGLGREGS
KYGIDEYLEMKYICIGNMLP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatcgcaagcgctggtgcgagtcaggctgtgcttgacaagatcaacaatgcg
gggctactgcgagccaaaggattgatctctggtgaatgggtgtccgctgaagacggtaga
acgctgcctgtttacaatcctgcgactggtgagtttttaacagaggttccgctcatgggg
gaaagagagacattgtcggccatcgactctgcacacaacgcgtttaagtcatggagtaaa
aagacatgttcggagagaagcaagcttctgcgtagatggtatgagctcatacttgagaaa
aaagaggagatagcccagctgatgactctagagcaaggaaagcctttgaaagaagccctt
ggtgaggtctcgtatggagctggcttcatagagctttttgccgaggaagcaaagcgcaca
tatggcgatattataccatcgccttatccagaccggcgattactcgttgtaaagcagcct
gttggtgttgtaggtacgataactccgtggaattttccccttgccatgatcacacgcaag
gttgctccagcacttgcagcaggctgcacagtagtgattaagcctgcagaacttacgccc
ttgactgcattagctgctgcagaactatccattcaagctggtataccccctggagtcatc
aacgttgtcatgggagatgctccgcaaatcggagctgcacttttggagagcactaaggtt
cgcaaaatctcattcactgggtctacacaagtcggtaaaaagcttatggctggagcagca
agtaccgtaaagcggttatctcttgaacttggtggaaatgcaccatgtatcatactggat
gatgcagacatagaagtggctgttaaaggagccttggcttccaagtaccggaatagcggc
cagacctgtgtttgtgccaatagagtccttgtccaagatggtatatatgacaagtttgcg
gaggcttttattcaagcggtatctggccttaaggttggaaatggtttggaagaaggggtc
acgcagggtcccctgattaatgaagcagctgtgaagaaggtagtagagcaacacgttgaa
gatgcattatcgaagggtgcaatgctcctggcgggaggccatcgacatagacttggtgcc
gccttttacgagccaactgttctcggagatgcaacagaagagatgctaataatgaaagag
gaagtttttgggcctgttgcacccctgatcagattcaaaacagacgaggacgcaatcagg
attgccaacagcaccgaagctggattggctgcgtatcttttttcgggaagcatctctaga
gcttggcgtgtggcggaggcattagaatatggaatggttggttggaacgaaggagtgatt
tctacggaggtcgctccattcggtggtgttaaacaatccgggcttggtcgtgagggatcc
aaatacggaatcgacgagtacttggagatgaagtacatatgcataggaaatatgttgcct
tga

DBGET integrated database retrieval system