KEGG   Selaginella moellendorffii: SemoP_p024Help
Entry
SemoP_p024        CDS       T01496                                 

Gene name
rbcL
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smo  Selaginella moellendorffii
Pathway
smo00630  Glyoxylate and dicarboxylate metabolism
smo00710  Carbon fixation in photosynthetic organisms
smo01100  Metabolic pathways
smo01110  Biosynthesis of secondary metabolites
smo01200  Carbon metabolism
Module
smo_M00165  Reductive pentose phosphate cycle (Calvin cycle)
smo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
smo_M00532  Photorespiration
smo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:smo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SemoP_p024 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SemoP_p024 (rbcL)
Enzymes [BR:smo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SemoP_p024 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 8302288
NCBI-ProteinID: YP_003097495
UniProt: C7B2G2
Position
PT
AA seq 475 aa AA seqDB search
TSPQTETKASVGSKAGVKDHRLTHYTPDYQTKDTDIPAASRMTPQPGVPAEEAGAAVAAE
SSTGTWTTVWTDGLTNLDRYKGRCYDIEPVPGEKDQYIAYAAHPSDLSEEGSVTNMSTSI
VGNVFGSKALRAPRSEDLRIPPAYSKTSKGPPHGIQVERDKSNKYGRPSLGCTIKPKLGL
SAKNYGRAVHERLRGGLDFTKDDENVNPQPFMRWRDRFVFVAEALYKAQSETGEIKGHHL
NATAGTCEEMMKRAEFARELGVPITMHDHSTGGFTANTSLAYYCRDNGLLPHIHRAMHAV
IDRQKNHGIHFRVLAKASRMSGGDHIHGGTVVGKLEGERQVTLGFVDLLRDDYIDKDRSR
GIHPTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAIEGNEVIREASKWSPELAAACEVWKEIKFEFETIDTI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
acgtcaccgcaaacggaaactaaagcaagtgttggatccaaggccggcgtgaaggatcac
agattaactcattacactcccgattaccagaccaaagacaccgatattccggcagcatcc
cgaatgactccgcaacccggagtgcccgccgaagaagcgggagccgcagtagccgcggaa
tcctccacaggaacgtggactaccgtttggaccgatggactgactaatcttgatcgttat
aaaggtcggtgctatgatatcgaacccgttccgggggaaaaagatcaatacattgcttat
gcagctcatccttcggacctgtctgaggaaggttccgttaccaacatgtccacctccata
gtgggtaatgtttttggatccaaggccttacgagccccgcgttcggaagatctgcgaatc
ccccccgcttattccaagacctccaagggtccaccccatggtatccaagtcgaaagggat
aaatcgaacaaatatggccgtccctcgctgggatgtactataaaacccaagttgggtcta
tccgctaaaaactacggcagagcagtccatgaacgtcttcgtggtggactcgatttcacc
aaagatgatgagaacgtaaatcctcaaccattcatgcgttggcgagatcgtttcgtattc
gtagcggaagctctttataaggctcagtccgaaacaggcgagattaagggtcatcacctg
aatgctaccgcgggtacatgcgaagaaatgatgaaaagggcagaattcgctagggaattg
ggagtgcccatcaccatgcatgaccattcgacaggaggttttaccgcaaatactagtctg
gcctattattgccgggacaatggtctactcccacacatccatcgcgcaatgcatgctgtt
attgacagacaaaaaaatcatggtattcatttccgtgtattggccaaagcatcacgcatg
tccggtggagatcacattcatggtggtaccgttgtgggtaagcttgagggggaacgccaa
gtaaccctaggtttcgtggatctgcttcgggatgattatattgataaagaccgaagtcgt
ggtattcaccctacccaggattgggtatctatgcctggtgtcttgcccgtcgcctccgga
ggcattcacgtttggcatatgcccgctttgaccgaaatatttggagatgattctgtatta
caattcggcgggggcactttgggccacccttgggggaacgcacctggtgcagtagcgaat
cgagtcgctttggaagcttgtgtacaagcccgtaacgaaggacgtgatctcgctattgag
ggtaatgaggttattcgtgaagctagtaagtggagtcctgaactagctgcggcttgcgag
gtatggaaagaaatcaagtttgaatttgaaacgattgacactatttga

DBGET integrated database retrieval system